KEGG   Rattus norvegicus (rat): 362782Help
Entry
362782            CDS       T01003                                 

Gene name
Cyp46a1
Definition
(RefSeq) cytochrome P450, family 46, subfamily a, polypeptide 1
  KO
K07440  cholesterol 24-hydroxylase [EC:1.14.14.25]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00120  Primary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    362782 (Cyp46a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    362782 (Cyp46a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.25  cholesterol 24-hydroxylase
     362782 (Cyp46a1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP46 family
   362782 (Cyp46a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Rab5-bind
Motif
Other DBs
NCBI-GeneID: 362782
NCBI-ProteinID: NP_001102193
RGD: 1306605
Ensembl: ENSRNOG00000007147
UniProt: A0A0G2JWG7
Position
6q32
AA seq 403 aa AA seqDB search
MSTKYNKDSKMYRAIQTVFGERLFGQGLVSECDYGRWYKQRRVMDLAFSRSSLVSLMGTF
NEKAEQLMEILEAKADGQTPVSMQDMLTCATIDILAKAAFGMETSMLLGAQKPLSQAVKV
MLEGISASRNTLAKFMPGKRKQLREIRESIRLLRQVGKDWVQRRREALKRGEDVPADILT
QILKAEEGAQDDEVLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVVG
SKRHLDYEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYV
MGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQR
LEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccaagtacaacaaggactccaagatgtaccgtgcgattcagactgtgttcgga
gagagactgtttggccagggcttggtgtctgaatgtgactatgggcgctggtataagcag
agaagagtcatggacttggccttcagtcgcagctccttggttagcctgatggggacgttc
aatgagaaggcagagcagctgatggaaattctagaagctaaggcggacggacagacaccg
gtgtccatgcaggacatgctgacctgtgccaccatcgacatcctggccaaggcagctttt
gggatggagaccagtatgctactgggcgcccagaaacccctgtcccaggcagtgaaggtc
atgctggagggtatcagtgcgtcccgtaacaccctggcgaagttcatgccagggaagaga
aagcagcttcgggagatccgagagagcatccgcctgttacgccaggtggggaaggattgg
gtgcagcgccgccgtgaggccctgaagaggggtgaggacgtgccggccgacatcctcacg
cagattctcaaagctgaagagggagcccaggacgacgaggttctgctcgacaactttgtt
accttcttcattgcgggtcatgagacttccgccaaccatctggcattcacagtgatggag
ttgtctcgacagccggagatcgtggcaaggctgcaggccgaggtggatgaggtggtcggt
tccaagcggcacctggactacgaggatctggggagactgcagtacctgtcacaggtcctc
aaagagtctctgaggctgtacccaccagcatggggcacctttcgcctgctggaagaggag
accttgattgatggggtcagagtccctggcaacactcctctcctgttcagcacctatgtc
atggggaggatggacacctactttgaggatccactgactttcaaccctgaccgcttcggc
cctggagcgcccaagccgaggtttacctacttccccttttccctgggccaccggtcctgc
atcgggcagcagtttgctcagatggaggtgaaagtcgttatggccaagctgcttcagagg
ctcgaattccggctggtacctgggcagcgctttgggctgcaagagcaggctacgctcaag
ccactggaccctgtgctgtgcaccctgaggccccggggctggcagcctgcacccccaccc
ccaccctgctga

DBGET integrated database retrieval system