KEGG   Rattus norvegicus (rat): 362791Help
Entry
362791            CDS       T01003                                 

Gene name
Siva1, Siva
Definition
(RefSeq) SIVA1, apoptosis-inducing factor
  KO
K22744  apoptosis regulatory protein Siva
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    362791 (Siva1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Siva
Motif
Other DBs
NCBI-GeneID: 362791
NCBI-ProteinID: NP_001094452
RGD: 1561872
Ensembl: ENSRNOG00000028640
UniProt: A4FTX4
Position
6q32
AA seq 157 aa AA seqDB search
MPKRSCPFTDAAPLQLKVHVSPRELSHGVFAERYSREVFERTKQLLFQGAQAYRDHIWGE
GCSINHLPEPLKPGLVGAPQAARGQMLIGPDGRLTRCQAQASEAGLPGAAPIACSSCVRS
VDGKAVCSQCERALCGQCVYTCWGCGALACVLCGLAE
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagcggagctgcccgttcacggatgctgccccgcttcaactcaaagtccacgtg
agcccgagagagctgagccacggtgtgttcgccgagcgctactcgcgcgaggtcttcgaa
agaaccaagcagctccttttccaaggggcccaggcctatagagatcacatctggggtgaa
ggttgttccatcaaccacctgccggagccactcaagcctggtctggtgggagcccctcaa
gctgcaaggggacagatgttgattggacctgatggccgactgacacggtgccaagctcag
gcctcggaagctggccttcccggggcagcacccattgcttgttcatcctgcgtgagatct
gtggatggaaaggcggtctgcagccagtgtgagcgggccctgtgtgggcagtgtgtgtac
acctgctggggctgtggtgccttggcctgtgtgctgtgtggcctggcagagtga

DBGET integrated database retrieval system