KEGG   Rattus norvegicus (rat): 362799Help
Entry
362799            CDS       T01003                                 

Gene name
Rapgef5, Mrgef, RGD1562891, rMR-GEF
Definition
(RefSeq) Rap guanine nucleotide exchange factor 5
  KO
K08019  Rap guanine nucleotide exchange factor 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    362799 (Rapgef5)
   04015 Rap1 signaling pathway
    362799 (Rapgef5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RA Peptidase_C58
Motif
Other DBs
NCBI-GeneID: 362799
NCBI-ProteinID: NP_001041380
RGD: 1561668
Ensembl: ENSRNOG00000005271
UniProt: P83900
Position
6q33
AA seq 580 aa AA seqDB search
MGSSRLRVFDPPLERKDSAALSERQLPLPTFDVPYFKYIDEEDEDDEWGSRSQSSTEDDS
VDSLLSDRYVVVSGTPEKILEHLLNDLHLAEVQHKETETLLDDFLLTYTVFMTTDDLCQA
LLRHYSAKKYQGEEENSDVPCRKRKVLHLVSQWISLYKDWLHEDEHSKMFLKTIYRNVLD
DVYEYPILEKELKEFQKILGMHRRHTVDEYSPQKKNKALFHQFSLKENWLQHRGTVAETE
EIFCHVYVTEHSYISVKAKVSSTAQEILKVVAEKLQRAEEDLALVAIMFSGEKHEFQPND
LAISKSLEASGRIYVYRKDLADTLNPFAENEESQQRSMRILGMNTWDLALELMSFDWSLF
NSIHEQELIYFTFSRQGSGEHTVNLSLLLQRCNEVQLWVATEILLCSQLGKRVQLVKKFI
KIAAHCKAQQNLNSFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFSELESLTDPSLNHKA
YRDAFKKMKPPKIPFMPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRTLRHCRTNQ
FGSDMSPKEQQELKSYVNHLYVIDSQQALFELSHRLEPRA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgggcagctcccgcctgcgggtctttgacccccctctagagaggaaagattccgccgcg
ctctcggagcgccagctgcccttgcctaccttcgatgtgccttatttcaaatacatcgac
gaagaagatgaggacgatgaatggggcagccgctcacagtcctccacggaggatgactca
gtggactctctgctctctgacagatatgtggtggtgtctgggaccccggagaagatcttg
gagcaccttttgaatgacttacacctggcagaggttcagcacaaagaaacagaaacactc
cttgatgacttcctcctcacgtatacggtattcatgacaaccgatgacttgtgccaggcg
ctgttaagacactattctgctaagaagtatcaaggggaagaagaaaactcagatgtccct
tgtcggaagcgcaaggtcttacatctggtttcccagtggatttctctgtacaaggactgg
ctgcatgaagatgagcactcaaagatgtttctaaagaccatatacaggaacgtgctggat
gacgtctatgaatatccgatccttgagaaagagctgaaggagtttcagaagatactgggc
atgcaccgccgtcacactgttgatgaatactcaccacagaagaagaataaagccctcttc
catcaattcagtcttaaggagaactggctccagcatagaggaactgtggccgaaacagag
gaaattttttgccacgtgtatgtgacggagcactcctacatcagtgtgaaggcaaaagtt
tctagtacagcccaggagatcctgaaggttgtggccgagaagctgcagcgtgccgaagag
gatctggctctggtggccattatgttctctggagaaaagcatgaatttcagccaaatgac
ttggccatttccaaatccctggaggcatctggtcggatatacgtctaccggaaagatctg
gctgacactttgaatccttttgcagaaaatgaggaatcccagcaaaggtcgatgaggatt
ttggggatgaacacttgggaccttgctctggaattaatgagttttgattggagtctgttc
aattcaatccacgagcaagaactcatctacttcacattcagcagacaggggagcggagag
cacactgtgaacctcagccttctgctccagagatgtaacgaggtccagctctgggtggcc
acggagattctgctctgcagccagctaggcaagcgcgtgcagctggtgaaaaaattcatc
aagattgctgctcactgcaaagcccagcagaacctaaactccttctttgccatcgtgatg
ggtctcaacaccgcctctgtcagccggctgtcacagacctgggagaaaattcctgggaag
tttaagaaacttttctctgaacttgagagtttaacggatccttccctaaaccacaaggcc
tacagggatgcattcaaaaagatgaagccgccaaaaatccctttcatgcccttactgctt
aaagatgtaacatttattcatgaaggaaataaaacattcctggataatcttgtcaatttt
gaaaagctgcacatgatcgcagatactgtccgaaccctgagacactgcaggactaaccag
tttggaagcgacatgtctccaaaggagcagcaagagctgaagtcctatgtcaaccacctg
tatgtcatcgacagccagcaagccctgttcgagctctctcacaggctggagcctcgagcc
tga

DBGET integrated database retrieval system