KEGG   Rattus norvegicus (rat): 362817Help
Entry
362817            CDS       T01003                                 

Gene name
Cdk2
Definition
(RefSeq) cyclin dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04115  p53 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04218  Cellular senescence
rno04914  Progesterone-mediated oocyte maturation
rno04934  Cushing syndrome
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05215  Prostate cancer
rno05222  Small cell lung cancer
rno05226  Gastric cancer
Module
rno_M00692  Cell cycle - G1/S transition
rno_M00693  Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    362817 (Cdk2)
   04151 PI3K-Akt signaling pathway
    362817 (Cdk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    362817 (Cdk2)
   04114 Oocyte meiosis
    362817 (Cdk2)
   04115 p53 signaling pathway
    362817 (Cdk2)
   04218 Cellular senescence
    362817 (Cdk2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    362817 (Cdk2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    362817 (Cdk2)
   05203 Viral carcinogenesis
    362817 (Cdk2)
  09162 Cancer: specific types
   05226 Gastric cancer
    362817 (Cdk2)
   05215 Prostate cancer
    362817 (Cdk2)
   05222 Small cell lung cancer
    362817 (Cdk2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    362817 (Cdk2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    362817 (Cdk2)
   05162 Measles
    362817 (Cdk2)
   05161 Hepatitis B
    362817 (Cdk2)
   05160 Hepatitis C
    362817 (Cdk2)
   05169 Epstein-Barr virus infection
    362817 (Cdk2)
   05165 Human papillomavirus infection
    362817 (Cdk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    362817 (Cdk2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    362817 (Cdk2)
   03036 Chromosome and associated proteins [BR:rno03036]
    362817 (Cdk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     362817 (Cdk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  CDK family
   362817 (Cdk2)
DNA replication proteins [BR:rno03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    362817 (Cdk2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    362817 (Cdk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 362817
NCBI-ProteinID: NP_955795
RGD: 70486
Ensembl: ENSRNOG00000006469
UniProt: Q6P751
Position
7q11
AA seq 298 aa AA seqDB search
MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF
PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggagaacttccaaaaggtggagaagattggagagggcacgtacggagtggtgtacaaa
gccaaaaacaagttgacgggagaagttgtggcgcttaagaaaatccggctcgacactgag
actgaaggtgtgcccagtactgccatccgagagatctccctccttaaggagctcaatcac
cctaacatcgtcaagctgctggatgtcatccacacagaaaataagctttatctggtgttt
gaattcctgcaccaggacctcaagaagtttatggatgcttctgctctcactggcattcct
cttcccctcatcaagagctatctgttccagctgctccagggcctagcattctgccattct
caccgtgtcctgcaccgagaccttaagccccagaacctgcttatcaacgcagaggggtcc
atcaagctggctgactttggactagcaagagcctttggagtccctgtccgtacttacact
catgaggtggtgaccctctggtaccgagcaccggagattcttctgggctgcaagtactac
tccacagccgtggacatctggagcctgggctgcatctttgccgaaatggtgacccgcagg
gccctattccctggagactctgagattgaccaactcttccggatctttcggactctgggg
accccagatgaggtggtttggccaggagttacttctatgcctgattataagccaagtttc
cccaagtgggctcggcaggattttagcaaggttgtgcctcccctggatgaagacggacgg
agcttgttatctcaaatgctgcactatgaccccaacaagcggatttcagccaaagcagcc
ctggctcaccctttcttccaggatgtgactaaaccagtgccccaccttcgactctga

DBGET integrated database retrieval system