KEGG   Rattus norvegicus (rat): 362819Help
Entry
362819            CDS       T01003                                 

Gene name
Sarnp, Cip29, RGD1305692
Definition
(RefSeq) SAP domain containing ribonucleoprotein
  KO
K18732  SAP domain-containing ribonucleoprotein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    362819 (Sarnp)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     362819 (Sarnp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAP Tho1_MOS11_C LETM1
Motif
Other DBs
NCBI-GeneID: 362819
NCBI-ProteinID: NP_001028242
RGD: 1305692
Ensembl: ENSRNOG00000030520
UniProt: Q498U4
Position
7q11
AA seq 210 aa AA seqDB search
MATETVELHKLKLAELKQECLARGLETKGIKQDLINRLQAYLEEHAEEEANEEDVLGDET
EEEEPKPIELPVKEEEPPEKVVDMASEKKVVKITSGIPQTERMQKRAERFNVPVSLESKK
AARAARFGISSVPTKGLSSDTKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKER
FGIVTSSAGTGTTEDTEAKKRKRAERFGIA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgagacggtggagctccacaagctgaagcttgctgaactaaagcaagaatgc
cttgctcgtggtttagagaccaagggaataaaacaagatcttatcaataggctccaggca
tatcttgaagaacatgctgaagaagaagcaaatgaagaagatgtactgggagatgaaact
gaggaagaagaaccaaagcctatagaactgcctgttaaagaggaagaacctcctgaaaaa
gttgttgatatggcatcagaaaagaaggtggtaaaaattacatctggaatacctcaaact
gagagaatgcagaagagggctgaacgtttcaatgtgcctgtaagcttggagagtaagaag
gctgctcgggcagcgaggtttggaatttcttcagttccaacaaaaggtttatcatctgac
accaagccaatggttaacctggataaactaaaggaaagagcacagagatttggtttgaat
gtctcttccatctctagaaagtctgaggatgatgagaagctgaagaaacggaaggagaga
tttggaattgtgacaagttcagctggaactggaaccacagaggatacagaggcaaagaaa
agaaaaagagcagagcgttttgggattgcataa

DBGET integrated database retrieval system