KEGG   Rattus norvegicus (rat): 362844Help
Entry
362844            CDS       T01003                                 

Gene name
Brd4
Definition
(RefSeq) bromodomain containing 4
  KO
K11722  bromodomain-containing protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    362844 (Brd4)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    362844 (Brd4)
   03036 Chromosome and associated proteins [BR:rno03036]
    362844 (Brd4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  BRD family [OT]
   362844 (Brd4)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Brd4/P-TEFb complex
     362844 (Brd4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    362844 (Brd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bromodomain BET BRD4_CDT
Motif
Other DBs
NCBI-GeneID: 362844
NCBI-ProteinID: NP_001094373
RGD: 1307282
Ensembl: ENSRNOG00000006770
UniProt: D3ZGX8
Position
7q11
AA seq 1403 aa AA seqDB search
MSTESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQSANAASTNPPPPETSNPNKPKRQT
NQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYW
NAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRG
RGRKETGTAKPGVSTVPNTTQASTSPQTQMPQQNPPPPVQATTHPFPAVTPDLIAQPPVM
TMVPPQPLQTPSPVPPQPPPPPAPVPQPVQSHPPIIATTPQPVKTKKGVKRKADTTTPTT
IDPIHEPPSLAPEPKTAKLGPRRESSRPVKPPKKDVPDSQQHPGPEKSSKISEQLKCCSG
ILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLESREYRDAQEFG
ADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVTVSSPAVPPPTKV
VAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKK
EKDKKEKKKEKHKKKEEMEENKKSKAKELPPKKTKKNNSSNSNVSKKEPAPTKTKPPPTY
ESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETL
KPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESTSESSSSDSEDSET
EMAPKSKKKGHTGRDQKKHHHHHHPQMQPAPAPVPQQPPPPPQQPPPPPPPQQQQQQQQQ
QPPPPPPPPSMPQQTAPAMKSSPPPFITAQVPVLEPQLPGSVFDPIGHFTQPILHLPQPE
LPPHLPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPAL
AQPPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQP
PPPLPPPPHPSVQQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLPSMPFSAHIQQPPP
PTGQQPTHPPPGQQPPPPQPAKPQQVIQHHPSPRHHKSDPYSAGHLREAPSPLMIHSPQM
PQFQSLTHQSPPQQNVQPKKQVKGRAEPQPPGPVMGRGQGCPPASPAAVPMLSQELRPPS
VVQPQPLVVVKEEKIHSPIIRSEPFSTSLRPEPPKHPENMKAPVHLPQRPEMKPVDVGRP
VIRPPEQSAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMGSWASLVQKHPTTPSSTAKSS
SDSFEHFRRAAREKEEREKALKAQAEHAEKEKERLRQERMRSREDEDALEQARRAHEEAR
RRQEQQQQQQRQEQQQQQQQQAAAVAAASAPQAQSSQPQSMLDQQRELARKREQERRRRE
AMAATIDMNFQSDLLSIFEENLF
NT seq 4212 nt NT seq  +upstreamnt  +downstreamnt
atgtctacggagagcggccctgggacaagattgagaaatctgccagtaatgggggatgga
ctagaaacctcccaaatgtctacaacgcaggcccaggcccaaccccagtcagcaaatgca
gccagcaccaatcctccacccccagagacctccaaccctaacaagcccaagaggcagacc
aaccaactgcaatatctgctcagagtggtgctcaagacactatggaaacaccagtttgcg
tggcctttccagcagcctgtggatgccgtcaagctgaacctccctgattactataagatt
attaaaacacccatggatatgggaacaataaagaagcgcttggaaaacaactattactgg
aatgctcaggaatgtatccaggacttcaacactatgtttacaaattgttacatctataac
aagcctggagatgacatcgtcttaatggcagaagctctggagaagctcttcttgcagaaa
atcaatgaactgcctacagaagaaaccgagatcatgatagtccaggcaaagggacgagga
cgagggaggaaagaaacagggacagcaaagcctggtgtatccacggtaccaaacacaact
caagcatcaacttctccgcagacccagatgcctcagcagaaccctcctccacctgtgcag
gccacaactcacccctttcctgctgtcaccccagacctcattgcccagcctcctgtcatg
acaatggtgcccccccagccacttcagactccttcaccggtaccccctcagccaccaccc
ccacctgctccagttccacagcctgtgcagagtcaccctcccatcattgcgaccacccca
cagcctgtgaagacaaagaaaggggtgaagaggaaagcagataccaccacccccaccacc
atcgaccccattcatgagccgccctcactggccccggagcccaagaccgccaagctgggt
cctcggcgggagagcagcagacctgtgaagcccccaaagaaggatgtaccagactcccag
cagcacccagggccagagaagagcagcaagatctctgagcagctgaagtgctgcagtggc
atcctcaaggagatgtttgctaagaaacatgctgcctatgcctggcctttctacaagccc
gtggatgtggaggcactgggtctgcacgactactgtgacatcattaaacaccccatggac
atgagcacaatcaagtctaaactagagtcccgggagtacagagatgcccaggagtttggt
gctgatgtccgattgatgttttccaactgctacaagtacaatccccctgaccatgaagtg
gtagccatggctcgaaaactccaggatgtgtttgaaatgcgctttgccaagatgcctgat
gagcctgaagagccagttgttacggtgtcctcccctgcagtgccaccccctacaaaggtg
gtagccccaccctcatctagtgacagcagcagtgatagttcctctgacagtgacagttcc
actgacgactctgaggaagagcgagcccagcggctggctgagctccaggagcagctcaaa
gccgtgcatgagcagcttgcagccctctcacagccccaacagaacaaaccaaagaaaaag
gagaaggacaagaaggaaaagaaaaaggaaaagcacaaaaagaaagaagaaatggaggaa
aataaaaaaagcaaagccaaggaacttcctcccaaaaagacaaagaaaaataacagcagc
aacagcaatgtgagcaagaaggaaccagcacccacgaagaccaagccgcctcccacatat
gaatcagaagaagaggacaagtgtaagcctatgtcttatgaggagaagcgacagctaagt
ctagatatcaacaaacttcctggtgagaagctaggccgtgtagtacacataattcagtcg
agggaaccatcacttaaaaactccaaccctgatgagattgagattgattttgagaccctg
aagccatctacactacgagagttggagcgatatgtcacctcctgtttgcggaagaaaagg
aaacctcaagctgaaaaagttgatgtgattgctggttcttccaagatgaagggcttctca
tcctctgagtcggagagcaccagcgaatctagctcctctgacagtgaagactctgaaaca
gagatggctcccaagtcaaaaaagaaggggcacactgggagggaccagaaaaagcatcat
caccatcaccacccacagatgcagccagccccagctcctgtgccccagcagccgccgcca
cctccacagcagcctcctccacccccacctcctcagcagcagcagcagcagcagcagcag
cagcccccacccccaccacctccgccctccatgccacagcagactgccccagcgatgaag
tcctcgcccccacccttcatcactgcccaggtacccgtcctggaaccacagctaccaggc
agtgtctttgaccctattggccacttcacccagcccatcttgcacctgccgcagccagag
ctgcctcctcacctgccccagccaccggagcacagcactccaccccatctcaaccagcat
gctgtggtctctcctccagctttgcacaatgcgctgccccaacaaccatctcggcccagc
aaccgagctgctgctctgcccccaaagcctgcccgacccccagctgtgtcccctgccttg
gcccagccccccctgctcccacagccacctatggctcagcccccccaagtgctgctggag
gatgaagagccgcctgccccacccctcacctccatgcagatgcagttgtacctacagcag
ctgcagaaggtgcagcctcccacaccactactcccttccgtgaaggtgcagtcccaaccc
ccaccacctttgccgcctccaccccacccttctgtgcagcaacagcagctccagcagcag
ccaccaccacccccacctcctcagccacagccaccaccccagcaacaacaccagccccca
ccacgaccagttcacttgccatccatgcccttctctgctcacattcagcagcccccacca
cccacaggacagcaacccacccacccacccccaggacagcagccacccccaccacagcct
gccaagcctcagcaagtcatccagcatcacccttcaccccggcaccacaagtcagacccc
tactcagctggtcatcttcgtgaagccccttctccgcttatgatacattcccctcaaatg
ccacagttccagagcctgacccatcagtctccaccccagcaaaacgtccagcccaagaag
caggtaaagggcagggctgagccacagcccccagggccagtcatgggccgaggccaggga
tgcccacctgcctcaccggctgccgtacctatgctgtcccaggagctgcgcccaccgtca
gtcgtccagccccagcccctggtggtagtgaaggaggagaagattcactcaccaatcatc
cgcagtgagccttttagcacctcacttcgcccagagccgcccaagcacccagagaacatg
aaggccccagtccacctgcctcagcggcctgagatgaagcctgtagatgtagggaggcct
gtgatccggcctccagagcagagtgcacccccaccaggggcccctgacaaggacaaacag
aaacaggagccaaaaacaccagtggcgcccaaaaaggacctgaaaattaagaacatgggc
tcctgggccagcctggtacagaagcatccgaccaccccatcctccacagccaagtcctca
agcgacagctttgagcatttccgccgcgctgctcgggagaaggaggagcgggaaaaggcc
ctgaaggctcaggctgagcacgcagagaaggagaaggagcggctgaggcaggagcgcatg
aggagccgagaggatgaggatgcgctggaacaggcacgtcgagcccatgaggaggcacga
cggcgccaggagcagcagcagcagcagcagagacaggagcagcagcagcagcagcaacag
caggcagctgctgtggccgctgcctccgccccccaggcccagagctcccagccccagtct
atgctggaccagcagagggagttggcccgaaagcgagaacaggagcggaggcgcagggag
gcaatggcagctacaattgacatgaatttccagagtgatcttttgtcaatatttgaagaa
aatcttttttga

DBGET integrated database retrieval system