KEGG   Rattus norvegicus (rat): 362858
Entry
362858            CDS       T01003                                 

Gene name
Polr3b
Definition
(RefSeq) DNA-directed RNA polymerase III subunit RPC2
  KO
K03021  DNA-directed RNA polymerase III subunit RPC2 [EC:2.7.7.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    362858 (Polr3b)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    362858 (Polr3b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    362858 (Polr3b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     362858 (Polr3b)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     362858 (Polr3b)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_7 RNA_pol_Rpb2_2 RNA_pol_Rpb2_4 RNA_pol_Rpb2_3 RNA_pol_Rpb2_5
Other DBs
NCBI-GeneID: 362858
NCBI-ProteinID: NP_001178807
RGD: 1565311
Ensembl: ENSRNOG00000007432
UniProt: D3ZV30
Position
7
AA seq 1133 aa
MDVLAEEFGSLTPEELAAPIPTVEEKWRLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMK
ANEKVTSDADPMWYLKYLNIYVGLPDVEESFNVTRPVSPHECRLRDMTYSAPITVDIEYT
RGSQRIIRNALPIGRMPIMLRSSNCVLTGKTPAEFAKLNECPLDPGGYFIVKGVEKVILI
QEQLSKNRIIVEADRKGAVGASVTSSTHEKKSRTNMAVKQGRFYLRHNTLSEDIPIVIIF
KAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQKAQIFTQMQALKYIGNKVRRQRMWGGG
PKKTKIEEARELLASTILTHVPVKEFNFRAKCIYTAVMVRRVILAQGDNKVDDRDYYGNK
RLELAGQLLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAIS
TGNWSLKRFKMDRQGVTQVLSRLSYISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLC
PSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLAGNLGVEDVNLLCGEELSYPNVFLVF
LNGNILGVIRDHKKLVSTFRLMRRAGYINEFVSISTNLTDRCVYISSDGGRLCRPYIIVK
KQKPAVTNKHMEELAQGYRNFEDFLHESLVEYLDVNEENDCNIALYEHTINKDTTHLEIE
PFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQKPMV
KTKTIELIDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLK
RYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPL
EGSNVPQQPQYKDVPITYKGATDSYIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSR
HGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHY
GTAFGGSKVKDVCEDLVRHGYNYLGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKM
HARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVC
GQCGLLGYSGWCHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRLKLAKYNE
NT seq 3402 nt   +upstreamnt  +downstreamnt
atggacgtgctagctgaggagttcgggagcctgactccggaggagctggctgcgccgatc
ccgactgtggaggaaaaatggaggctgcttccagcatttttaaaggtaaaaggcctggtg
aaacagcacatcgactcctttaactatttcattaatgtagagataaagaagataatgaaa
gccaacgaaaaggttacaagcgatgctgatcccatgtggtacttaaagtatcttaatatc
tatgttggacttcctgacgtcgaagaaagcttcaatgtaactagaccagtgtcccctcat
gagtgccgtctgcgggacatgacgtactccgcccccatcaccgtggacatcgagtatacc
cgaggcagccagaggataatccgcaatgccttacccattggcagaatgcccatcatgctc
cgaagttcaaactgtgttctgacagggaaaactccagcagagtttgccaaactcaacgag
tgtccattagacccaggtggctacttcatcgttaaaggagtggagaaagtcattcttatc
caggagcagctgtccaagaacaggatcattgtggaggcagacaggaagggggctgttggg
gcttcagttaccagctccacccacgagaaaaaaagtagaaccaacatggcggtgaaacaa
gggcgcttttatctgaggcataacaccctgtctgaagatatacccattgtcatcatattc
aaggccatgggtgttgagagtgaccaggaaattgtgcagatgattggaacggaggagcac
gtgatggctgcgtttgggcccagcctggaggagtgccagaaagctcagatcttcacccag
atgcaggcgttgaagtatatagggaataaagtaagaagacaaagaatgtggggaggtgga
ccaaagaagaccaaaatagaagaagcaagagaacttctggcctctaccattctgacccat
gtaccagttaaggaattcaatttccgagctaagtgtatctacacggcagtgatggtgcga
agggtgatcttggcccaaggagataacaaggtcgatgacagagactattacggcaacaag
cgactggagctggcaggccagctcttgtctcttctttttgaagatttgtttaaaaagttt
aattcagaaatgaagaagattgcagaccaagtgattcctaaacaaagagcagcccagttt
gacgtcgtgaaacacatgcgccaagaccagattaccaatggcatggtcaatgccatctcc
acgggaaattggtctctgaagagatttaagatggaccggcagggtgtgacccaagtgctg
tctcgcttgtcctatatatctgcacttggcatgatgacaagaatctcttcccagttcgaa
aaaacaagaaaagtgagtggccctcgttctctgcagccatctcagtggggaatgctctgt
ccctccgacacacctgaaggagaggcctgcggtttggttaagaacttggccctcatgaca
catataacaaccgacatggaagatggacccattattaagttagctgggaacttgggagta
gaagatgtgaatttattatgtggagaagagctctcttacccaaatgtattccttgtcttc
ctgaatggtaacatcctgggtgtcattcgagaccataaaaagcttgtgagcacgttccgg
ctgatgcgaagagcaggctacatcaatgaatttgtctccatctccacaaaccttacggac
cgatgtgtttacatttcctctgatggcgggcgcttgtgcaggccttacatcattgtcaag
aaacagaagcccgcagttaccaataagcacatggaagagctggctcaaggttacaggaat
tttgaagatttcttacatgagagtctggttgagtacttagatgtgaatgaagaaaatgat
tgtaacattgcgctctacgaacatacaattaataaagacaccacccacttggagattgaa
cccttcactcttctcggtgtttgcgccggcctgatcccgtaccctcatcacaaccagtct
ccaagaaacacctaccagtgtgccatgggcaagcaagccatgggtaccattggatacaat
cagcgaaacagaattgatacactaatgtatctactagcatatccacaaaaacccatggtt
aaaacaaaaaccattgagttgatagactttgagaaattgccagctgggcagaatgcaact
gttgccgtgatgagctacagcggctatgacattgaagacgcccttgttttgaacaaggcc
tctctggacagaggttttgggcgttgtctcgtctataaaaacgctaagtgcacattgaag
cgatataccaatcagacttttgataaggtgatgggtcccatgttggatgctgctaccaga
aaacccatctggcgacatgaaattttagatgcagatggcatttgttctccaggtgagaaa
gtagaaaacaagcaggtgcttgtaaacaagtccatgcccacagtgactcagattcctctg
gaagggagcaacgtgccacagcagccacagtataaggatgtgcccatcacgtacaaaggt
gcaacagactcttacatcgagaaagtgatgatctcttccaacgctgaggacgctttcctc
atcaagatgctcctgagacagacgcggcgtccagagatcggagacaaattcagcagtcgc
catggacaaaagggtgtctgcggcctgatcgtcccccaagaagacatgccgttctgtgac
tctggcatctgtcccgacatcataatgaaccctcacggcttcccatcgagaatgacggtt
ggaaagttgattgagttgctggccggcaaggcaggcgtgttagacggcaggttccactac
ggcaccgcctttggagggagtaaagtgaaggacgtgtgtgaagacctcgttcgccatggt
tacaactacctggggaaggactatgtcacctcgggcatcaccggtgagcccttagaagcc
tacatctattttgggcctgtgtactatcagaaactgaaacacatggtgctggataaaatg
catgcccgggccagaggaccacgagctgtccttaccaggcagcccactgaagggcgatct
cgcgatggcggcctgcgtcttggagaaatggagcgtgactgtttaattggctatggagcg
agtatgcttttgctggagagactaatgatctcaagtgatgccttcgaagttgacgtctgt
gggcagtgtggactacttggatattctggctggtgtcactactgcaagtcctcgtgccac
gtgtcctccctccgcatcccatatgcctgcaagctgctcttccaggagttgcagtccatg
aacatcatccccaggttgaaactggccaagtacaacgagtaa

DBGET integrated database retrieval system