KEGG   Rattus norvegicus (rat): 362860Help
Entry
362860            CDS       T01003                                 

Gene name
Appl2, RGD1563028
Definition
(RefSeq) adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 2
  KO
K20132  DCC-interacting protein 13-beta
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    362860 (Appl2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    362860 (Appl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR_3 PH PID PTB DUF3263 PH_17 PH_9 PH_2 Peptidase_S9_N
Motif
Other DBs
NCBI-GeneID: 362860
NCBI-ProteinID: NP_001102211
RGD: 1563028
Ensembl: ENSRNOG00000008174
UniProt: B4F779
Position
7q13
AA seq 662 aa AA seqDB search
MPAVDKLLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQ
LSRQLLAYEKQNFALGKGDEEVISTLHYFSKVMDELNGLHSELAKQLADTMVLPVIQFRE
KDLTEVSTLKDLFGLASNEHDLSMAKYSRLPKRKENERVKTDVAKEVAAARRKQHLSSLQ
YYCALNALQYRKRAAMMEPLIGFAHGQINFFKKGAEMFSKSMDGFLSSVTDMVQSIQVEL
EAEADKMRVSQQELLSVSESVYTPDIDVATPQINRNLIQKTGYLNLRNKTGLVTTTWERL
YFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQISTPSGKPGIILQAESR
KEYEEWICAINNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESFYFSQNIKNS
DTGYVKIVPKAAASIPETEELIAPGTPIQFDIVLPATEFLDQNRGSRRINPFGETEDDSF
PDAEDSLLQQMFIVRFLGSMAVKTDSTTEVIYEAMRQVLAARAIHNIFRTTESHLMVTSQ
TLRLIDPQTQVSRACFELTSVTQFAAHQENKRLVGFVIRVPESTGEESLSTYIFESNSEG
EKICYAINLGKEIIEVQKDPEALARLMLSVPLTNDGKYVLLNDQADDTGGSPSDHRGAES
EA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgtggacaagctcctgctggaggaggcgctgcaggacagcccccagacgagg
tccctgctgagtgtctttgaagaggatgctggcaccctcacagactacaccaaccagctg
ctgcaggcgatgcagcgtgtctatggtgcacagaatgaaatgtgtctggccacgcaacag
ctttccaggcagctgctggcatatgaaaaacagaattttgcactgggcaaaggcgacgaa
gaagtaatttctacactacattatttttccaaagtgatggatgagctcaatggtctccac
tcagagctggccaagcaactggcagacactatggttctccctgttatacagttccgagag
aaggatctcacagaggtcagcactttgaaggatctctttggacttgccagcaatgagcat
gacctgtcaatggcaaaatacagcaggctccctaagagaaaggagaacgagagggtgaag
acggacgttgcaaaggaggtggcagctgcccggcggaaacagcatctgtcatcccttcag
tactactgtgcactgaacgcactgcagtaccgcaagagggcagccatgatggagccgctc
ataggctttgcccatggacagattaactttttcaagaaaggagcagagatgttctccaaa
agtatggacggtttcttatcatccgttacagacatggttcagagcattcaggtggaactg
gaagccgaggccgacaagatgcgggtgtcccagcaggagctgctttcagtcagtgagtct
gtttacactccggacatcgatgtggccacaccgcagatcaacaggaacctcatccagaag
actggctacctcaatctcagaaacaagacgggactggtcaccaccacatgggaaaggctg
tacttcttcacccaaggcgggaacctcatgtgccagcctaggggagctgtggctggaggc
ttgattcaggacctggacaactgctctgtgatggcggtggattgcgaagaccgacgatac
tgcttccagatctccacgcccagtggcaaaccggggataattctccaggcagagagcaga
aaggaatatgaagagtggatatgtgcaataaacaatatctccaggcagatctacctgaca
gacaacccagaggcagtagccatcaagttgaatcagacggctcttcaggcggtgactccg
attacaagctttgggaaaaaacaagaaagcttctacttcagtcaaaacataaaaaattca
gacacaggatatgtcaagattgttcccaaagcagcagccagcattcctgagacagaggaa
ctgattgcacctgggacacccattcagtttgacattgtacttcctgcaacggaattcctt
gaccagaacagaggcagcaggcgcatcaacccttttggtgagacggaggatgactcattt
ccggacgcagaagactctctcttgcagcagatgttcatcgttcggtttttgggatcgatg
gcagttaagacagacagcactacggaagtgatttatgaagcgatgcgacaagtactggct
gctcgggctattcacaacatcttccgcaccacggagtcccacctgatggttaccagtcag
actctgaggttgatagatcctcagactcaagtgtcacgggcctgttttgagctcaccagt
gtcacacagtttgctgctcatcaagaaaacaaaaggctggttggcttcgtcatccgagtg
ccggagtctacaggagaagagtctctgagcacatacatttttgaaagcaactcagaaggc
gagaagatatgttatgctattaatttggggaaagaaattattgaggttcaaaaggatcca
gaagcactggctcgattaatgctgtctgtaccactaaccaatgacggaaaatatgtactg
ttaaacgatcaagcagatgacactggcggaagtccaagtgaccacagaggcgcagagtct
gaagcataa

DBGET integrated database retrieval system