KEGG   Rattus norvegicus (rat): 362861Help
Entry
362861            CDS       T01003                                 

Gene name
Slc41a2
Definition
(RefSeq) solute carrier family 41 member 2
  KO
K15122  solute carrier family 41
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    362861 (Slc41a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC41: MgtE-like magnesium transporter
   362861 (Slc41a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MgtE
Motif
Other DBs
NCBI-GeneID: 362861
NCBI-ProteinID: NP_001102212
RGD: 1307292
Ensembl: ENSRNOG00000008713
UniProt: D4A7D4
Position
7q13
AA seq 548 aa AA seqDB search
MTHSKGRPATYKTSASPESGGGFVDWTLNLNTIQSDKFLNLLLSMVPVIYQKNQEDRHKK
VNGIWQDGLSGAAQTFSKRSEPHLDYHEFSEQAFHSGGGHTPASCSPRYDDYAGYNYCDG
REASETTAMLQDEDPSSQGDDVIVETSQRLPKESSGVMALQILVPFLLAGFGTVSAGMVL
DIVQHWEVFKNVTEVFILVPALLGLKGNLEMTLASRLSTAVNVGKMDSPIEKWNLIIGNL
ALKQVQATVVGFLAAVAAIILGWIPEGKYYLSHSILLCSSSVATAFIASLLQGIIMVGVI
VGSKKTGINPDNVATPIAASFGDLITLAILAWISQGLYSCLAAKHPATRTVLHSGWEPVI
TAMVISSIGGLILDTTVSDPNLVGIVVYTPVINGIGGNLVAIQASRISTYLHLHSLPGEL
PEEPKGCSYPFRTFFGSGVNNKSAQVLLLFVIPGHLIFLYTIHLMKSGHTSLTVVFVVVY
LLAAVLQVFTLLWIADWMVHRFWRKGKDPDSFSIPYLTALGDLLGTALLALSFHFLWLIG
DRDGDVGD
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgacccacagtaaaggaagacctgccacttacaagacaagtgccagtccggagagcgga
gggggttttgtagattggactttaaatttaaatacaattcaatctgacaagtttctaaac
ttactgttaagcatggtgccagtcatttaccagaaaaaccaggaagacaggcataaaaaa
gtcaacggcatttggcaggacgggctgtctggtgcggcacaaactttcagcaagagatcg
gagccacatctggactaccatgagttctccgagcaggccttccacagcggcggtggccat
accccagccagctgcagccccaggtacgacgactatgccggctataactactgtgacgga
agggaggcctcagaaaccaccgccatgttacaagatgaagatccgtccagtcagggcgat
gacgttattgtggaaacaagccagaggctcccgaaggaatccagtggagtcatggctctg
cagatacttgtgccattcttgctggccggttttggaactgtttccgctggcatggttttg
gacatagtgcagcactgggaggtgttcaaaaacgtgacagaagtcttcattttggtgccc
gcgcttcttggtctgaaagggaacttggaaatgacattggcgtctcgattatccactgca
gtgaatgtcgggaagatggactcacccattgagaagtggaatctaatcataggcaacttg
gctttgaagcaggtgcaggccacagtagttggttttctggcagctgtggcagcgatcata
ctgggctggattccggaagggaaatattacctcagccattccatactcctgtgctccagc
agtgtggcaaccgccttcattgcgtctctcctgcagggaataataatggttggagttatc
gttggctccaagaagacaggcataaaccccgacaacgtggccacacccattgctgctagt
tttggtgatctgataactctggccatattagcttggataagtcagggtttgtactcctgt
cttgctgccaagcacccagctaccaggacagtgctccactcgggctgggagccagtcata
acagccatggttataagcagcatcgggggccttattctggacacaaccgtatctgaccca
aacttggttgggattgttgtttacacgccagttatcaacgggatcggtggcaatttggtg
gccattcaggctagcaggatttctacctacctccatttacacagcctccccggagaacta
cctgaggagcccaaaggctgctcctacccatttaggacgttttttggttcaggagtgaac
aataagtctgcccaggttctcctgctcttcgtgattcccggccacctgatcttcctctac
acaatccatctgatgaagagcggccacacctctctgactgtagtctttgttgttgtgtac
ctgcttgctgctgtgctccaggtgttcaccctgctgtggatcgctgactggatggtccat
cgcttctggaggaaaggaaaggacccagatagtttctccatcccgtacctgacggcgcta
ggcgacctgcttgggaccgctctgctggccttaagcttccattttctctggcttatcgga
gaccgagatggcgacgttggagactaa

DBGET integrated database retrieval system