KEGG   Rattus norvegicus (rat): 362862
Entry
362862            CDS       T01003                                 
Symbol
Hsp90b1
Name
(RefSeq) endoplasmin precursor
  KO
K09487  heat shock protein 90kDa beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno04151  PI3K-Akt signaling pathway
rno04657  IL-17 signaling pathway
rno04915  Estrogen signaling pathway
rno04918  Thyroid hormone synthesis
rno05132  Salmonella infection
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05215  Prostate cancer
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    362862 (Hsp90b1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    362862 (Hsp90b1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    362862 (Hsp90b1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    362862 (Hsp90b1)
   04918 Thyroid hormone synthesis
    362862 (Hsp90b1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    362862 (Hsp90b1)
   05207 Chemical carcinogenesis - receptor activation
    362862 (Hsp90b1)
  09162 Cancer: specific types
   05215 Prostate cancer
    362862 (Hsp90b1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    362862 (Hsp90b1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    362862 (Hsp90b1)
   05418 Fluid shear stress and atherosclerosis
    362862 (Hsp90b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    362862 (Hsp90b1)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP90
   362862 (Hsp90b1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF4518
Other DBs
NCBI-GeneID: 362862
NCBI-ProteinID: NP_001012197
RGD: 1310482
Ensembl: ENSRNOG00000026963
UniProt: Q66HD0
Position
7:complement(21110431..21124762)
AA seq 804 aa
MRVLWVLGLCCVLLTFGFVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALAGNEELTVKIKCDREKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVRKYSQFINFPIYVWSSKTETVEEPLEEDETAQ
EEKEEADDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHSTDITSLDQYVERMKEKQDKIYF
MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKSKESREATEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRVKEDEDDKTVMDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPEAQVEEEPEEEPEDTTEDTTDDSEQDEEE
TDAGAEEEEEEQETEKEPTEKDEL
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgagggtcctgtgggtgctgggcctctgctgcgtcctgctgaccttcgggtttgtgaga
gctgacgatgaagtcgatgtggatggcacggtagaagaggacctgggtaaaagtagagaa
ggctcacggacagacgatgaagttgtgcagagagaggaagaagctattcagttggatggt
ttaaatgcatcacaaataagggaacttagagaaaaatcggaaaagttcgccttccaagct
gaagttaacaggatgatgaaacttatcatcaattctttgtataaaaataaagagattttc
ctgagagaactgatttcaaatgcttctgatgctttagacaagataaggctcatctcacta
actgatgaaaatgcacttgctggaaatgaggagttgacggtcaagattaagtgtgacaga
gagaaaaacctgctgcatgtcacagacacgggtgtaggaatgaccagagaggagctggtt
aaaaacctgggcaccatagccaaatctggaaccagcgagtttctaaacaaaatgacagaa
gcacaagaagacggtcagtcaacttccgaactgatcggccagtttggtgtcggtttttat
tctgccttccttgtagcagataaggtcattgtcacgtcgaaacacaacaatgatacccag
cacatctgggaatccgactctaatgaattctctgtgattgctgacccaagaggaaacaca
ctaggtcgtggaacaacgattactcttgtcttaaaagaagaagcatctgattaccttgaa
ttggatacaattaaaaatctcgtcagaaagtattctcagttcatcaactttcccatctat
gtgtggagtagcaagactgagactgtggaggagcccttggaagaagacgaaacagcacaa
gaagagaaggaggaagctgatgatgaagccgcagtagaagaggaggaggaagagaagaag
ccaaagacgaagaaagttgaaaagactgtgtgggactgggaacttatgaatgacatcaaa
ccaatatggcagaggccgtccaaagaagtagaagaagacgagtacaaagctttctacaag
tcgttttcaaaggaaagtgatgaccccatggcttatatccactttactgcagaaggggaa
gtcaccttcaagtcaattttgtttgtgcctacatctgcgcctcgaggtctgtttgacgag
tatggatctaagaagagcgattatattaagctctatgtgcgccgagtgttcatcacagac
gacttccatgacatgatgcccaagtacctgaattttgtcaaaggtgttgtggattccgat
gatctccccctcaatgtttcccgtgagactcttcagcaacataaattgctcaaggtgatt
aggaagaagcttgtccgcaaaactctggacatgatcaagaagatcgctgatgagaaatat
aatgacactttctggaaagaatttggcaccaatatcaagcttggtgtgattgaagatcac
tcaaatcgaacacggcttgctaaacttcttaggttccagtcttctcaccattcaactgac
attactagtttagaccagtatgtggaaagaatgaaggaaaaacaggacaaaatctacttc
atggctgggtcaagcagaaaagaggctgaatcttctccgtttgttgagaggcttctgaag
aagggctatgaagttatttacctcacagagcccgtggatgaatactgcattcaggctctt
cctgagtttgatgggaaacggttccagaatgttgccaaagaaggagtgaagtttgatgag
agtgagaaaagtaaagaaagtcgggaagcaacagagaaggagtttgagcctctgctcaac
tggatgaaagataaggccctcaaggacaagatcgaaaaggctgtggtgtcccagcgcctc
acagagtctccctgtgcccttgtggccagccagtatggatggtctggaaacatggagagg
atcatgaaggcacaagcataccagacgggcaaggacatctctacaaattactatgccagt
cagaagaaaacgtttgaaattaatcctagacacccactgatcagggacatgctgcggagg
gttaaggaagatgaagatgacaagactgtcatggatcttgctgtagttttgtttgaaacg
gcaactcttcggtcaggataccttctacccgacaccaaggcatatggagacaggatagaa
aggatgctccgcctcagcttaaacattgaccctgaagcacaggtagaggaagagccagag
gaggagcctgaagacaccacagaagacaccacagatgactccgagcaggatgaagaagag
acagacgcaggggcagaagaagaagaagaagaacaggaaacagaaaaggaacctacagag
aaggatgaattgtaa

DBGET integrated database retrieval system