KEGG   Rattus norvegicus (rat): 362867Help
Entry
362867            CDS       T01003                                 

Gene name
Mybpc1
Definition
(RefSeq) myosin binding protein C, slow type
  KO
K12557  myosin-binding protein C, slow-type
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    362867 (Mybpc1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     362867 (Mybpc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 fn3 ig Ig_2 THB V-set C2-set_2 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 362867
NCBI-ProteinID: NP_001094228
RGD: 735102
Ensembl: ENSRNOG00000056493
UniProt: Q63518
Position
7q13
AA seq 1167 aa AA seqDB search
MPEPTKKEENEVPAPAPPPEEPNKDKEAGTTPAKEEDEASPPSALPPGLGSRALERKDSE
WSLGESPAGGEEQDKQNANSQLSTLFVEKPQTGSVKVGANITFIAKVKAEDLLRKPTVKW
FKGKWMDLASKAGKHLQLKETFERQTRIYTFEMQIIKAKENYAGNYRCEVTYKDKFDSCS
FDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPEIDVWELL
KNANPNEYEKIAFQYGITDLRGMLKRLKRMRRVEKKSAAFAKILDPAYQIDKGGRVRFVV
ELADPKLEVKWFKNGQEIRPSTKYIFEHKGNERIMFINNCALTDDSEYYVTAGDEKCSTE
LFVREPPIMVTKQLEDMNAYCGERVELEVEVSEDDANVKWFKNGEEIVPGPKSRYRIKVE
GKKHTLIIEGATKADSAEYSVMTTGGQSSAKLSVDLRPLKITTPLTDQTVKLGKEVCLKC
EISENVPGKWTKNGLPVQEGERLKVVHKGRIHKLVIANALIEDEGEYVFTPDAITVPLVC
QIHVIDPPKIILDGLEADNTVTVIAGSKLRLEIPVTGEPPPKAIWSRADKAIMEGSGRIR
AESYPDSSTLVIDVAERDDSGVYNINLKNEAGEAHASIKLRLWISLILRLAPNVTEVGDD
WCIMNWEPPVYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRI
FAVNAIGISKPSMPSKPFVPLAVTSPPTLLAVDSVTDSSVTMKWRPPDQIGAAGLSGYVL
EYCFEGSTSAKQSNENGEAANDLPAEDWSLQTQTGSTRPKFTITGLPTDAKIFVRVKAIN
AAGASETKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWK
KDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLEVKVDKYVENASIDIQIVDRPGP
PQAVTIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTNATITE
LVIGNEYYFRVFAENMCGLSEDATMTKESAVIAKDGKIYKNPVYEDFDFTEAPMFTQPLV
NTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDG
GTYCCKAVNDLGTVEIECKLEVKVVAQ
NT seq 3504 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacccactaagaaagaggaaaatgaagtgcccgccccagcccctcccccagaa
gaaccaaataaagacaaagaggcgggaaccactccagcaaaagaggaagatgaggcctct
ccgccgagtgccctgcctccaggtttgggtagtcgggccctggagagaaaagattcagaa
tggtctcttggtgagtcacctgctggcggggaggagcaggacaaacagaatgccaactca
cagctgtccaccctgtttgttgaaaaaccgcaaaccggatcggtgaaagtcggtgcaaac
atcacctttatagccaaagttaaggctgaagatcttcttaggaaacccactgtcaaatgg
ttcaaggggaaatggatggaccttgccagcaaagcagggaaacacctgcagctgaaggag
accttcgagaggcaaactcggatatacacatttgaaatgcagatcatcaaggccaaagag
aactatgcaggaaattacaggtgtgaggtcacctacaaggataaatttgacagctgttca
tttgatcttgaagtacatgaatctactgggactactccaaacattgacatcagatctgcc
ttcaaaagaagtggagaaggtcaagaagatgcaggggagcttgactttagtggtctcctg
aaacgtagggaggtgaaacagcaggaggaggagcccgagatagacgtgtgggagctgctg
aaaaatgccaacccaaacgagtacgagaagatcgctttccagtacggcatcaccgacctg
cgtggcatgcttaagcggctcaagcgcatgcgcagggtggaaaagaagagtgcagctttt
gcgaaaatcctcgaccctgcatatcagatcgataaagggggccgagtaagattcgttgtg
gaattagcagacccaaagctggaagtgaaatggtttaaaaatggccaagagattcgaccc
agcaccaaatacatctttgagcacaaaggaaatgagagaatcatgtttattaataactgt
gcactgacagatgattcggagtactacgtgacagctggagatgagaaatgttctactgag
ctctttgtaagagagcctccaattatggtaacaaagcagctggaagacatgaacgcttac
tgtggggagagagtagagctggaagtcgaggtgtctgaagatgacgccaatgtgaagtgg
tttaagaatggtgaagagattgtccctggtccaaagtcaaggtacagaattaaagtggaa
ggcaaaaagcacactttgatcatagaaggagcgacaaaggctgacagtgcggagtactcg
gtcatgacaaccggaggacagtcatcggctaaactaagtgttgacttgagacctctaaag
atcacaacgcctctgactgatcagactgtaaaacttgggaaagaagtatgcctgaagtgt
gaaatctctgaaaatgtaccaggaaaatggacaaaaaatggactccctgttcaggagggg
gaacgtctgaaggtcgttcacaagggaaggatccacaagttagtcatagccaatgctctc
attgaagacgaaggtgaatatgtgtttacaccagatgccatcactgttcctttggtctgc
caaattcacgtcatcgaccctcccaagatcatccttgacggcctggaggctgataacacc
gtgacagtgattgccggaagcaagcttcgtctggagattcccgtcacaggggaaccacct
cccaaagccatctggagcagagcagataaggctatcatggagggcagtggtcggataagg
gcagaatcctaccccgacagcagcacgctggtcattgacgtggcagagagagatgactct
ggtgtgtacaacataaatctgaaaaatgaagctggagaagcacacgcaagcatcaagtta
aggttgtggatatccctgatcctccggttggcaccaaatgtgacagaagtgggagatgac
tggtgcatcatgaactgggagcctcctgtctatgatggagggtctccaattttaggatac
tttattgagaggaaaaagaagcaaagctccaggtggatgagactgaattttgatctctgc
aaagagacaacttttgagcccaagaagatgattgaaggggtggcctacgaggtccgcata
tttgcggtcaatgccattggcatctccaagcccagtatgccctccaagccctttgttcct
ttggctgtgaccagccctccaactcttctggctgtcgactccgtgaccgactcctctgtg
acaatgaagtggaggcccccagaccagattggtgctgcaggtttgagtggctatgtgcta
gagtattgctttgaaggaagtacatcagcaaaacagtctaatgaaaatggggaggctgcg
aatgatctaccagctgaggactggtcactgcaaacacagaccggatcgacaagacccaag
ttcaccatcactggtctgcccacggatgcaaagatctttgtacgcgtgaaggctattaac
gcggctggggccagtgagaccaagtactattctcagcccatccttgtgaaggaaatcatt
gagccaccaaagattcgcatcccaaggcacctgaagcaaacttacatccgtagagttgga
gaagctgtaaatctggtgattcctttccagggcaaaccaagaccagaactgacctggaag
aaggacggtgcagaaatcgacaagaatcaaataaacattcgcaactcagagactgatacc
atcatattcattaggaaagcagagcgcagccactcaggcaaatacgacctggaggtcaag
gtggataagtacgtggaaaacgcctcgatcgacatccagatcgttgaccgcccaggccca
ccccaggctgtgactattgaagatgtgtggggagagaatgttgctctaacatggacacca
ccaaaggatgatgggaatgctgccatcacagggtacaccatccagaaggccgacaagaaa
agcatggaatggttcaccgtcattgagcattaccaccgaaccaatgccaccattaccgag
ctggtcataggaaacgagtattacttccgggtctttgctgaaaacatgtgcggccttagc
gaggacgcgaccatgacgaaggagagtgctgtgattgccaaggacggtaagatctataaa
aatccggtgtacgaagacttcgatttcacagaggcccccatgtttactcagcctttggtt
aacacctatgccatcgctggttacaatgccaccctgaactgcagcgtccgaggaaatccc
aagcccaaaatcacctggatgaaaaacaaagtggcgattgtggatgacccaagatacaga
atgttcagcaaccaaggagtctgtaccctggagatccgtaagcctagtccctatgacgga
ggcacgtactgctgcaaagcagtcaatgacctcgggacagtggagatcgaatgcaaactg
gaggtgaaagttgtagcacagtaa

DBGET integrated database retrieval system