KEGG   Rattus norvegicus (rat): 362896Help
Entry
362896            CDS       T01003                                 

Gene name
Stat6
Definition
(RefSeq) signal transducer and activator of transcription 6
  KO
K11225  signal transducer and activator of transcription 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04630  Jak-STAT signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno05161  Hepatitis B
rno05200  Pathways in cancer
rno05321  Inflammatory bowel disease (IBD)
Module
rno_M00684  JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    362896 (Stat6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    362896 (Stat6)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    362896 (Stat6)
   04659 Th17 cell differentiation
    362896 (Stat6)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    362896 (Stat6)
  09163 Immune diseases
   05321 Inflammatory bowel disease (IBD)
    362896 (Stat6)
  09172 Infectious diseases: Viral
   05161 Hepatitis B
    362896 (Stat6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    362896 (Stat6)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    362896 (Stat6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT6_C STAT_bind STAT_int STAT_alpha SH2
Motif
Other DBs
NCBI-GeneID: 362896
NCBI-ProteinID: NP_001037715
RGD: 1309063
Ensembl: ENSRNOG00000025023
UniProt: Q1KQ07
Position
7q22
AA seq 841 aa AA seqDB search
MSLWSLVSKMSPEKLQRLYVDFPQHLRHLLAEWLENQPWEFLVGSDAFCYNMASALLSAT
VQRLQASAGEQGKGSSLLQHISTLESIYQRDPLKLVATIRQILQGEKKAVIEEFHHLPGP
FHRKQEELKFTTALGRLQHRVRETRILRESLQQGTKTAQVSLKNLIDPPANGTGPSEDLA
TMLQGTVGDLEATQALVLKRIQIWKRQQQLAGNGTPFEESLAGLQERCESLVEIYSQLQQ
EIGAASGELEPKTRASLISRLDEVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLQ
FLGTSAKPPLVRADMVTEKQARELSLPQGSGAGVESTGEIMNNTVPLENSVPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSTSFMLGPNKHLIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTSRGLLPEHFLFLAQK
IFNDNSLSIEAFQHRCVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSSQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVSTTIKMTVERDQPLPTPE
PQMPAMVAPYDLGMAPDASMQLSSDMVYPPQSHSIHSFQSIPLEESMSVLPPFQEPHLQM
PPTMSQISMPFDQPHPQGLLQCQSQEHAVSSPEPLLCSDVTMAEDSCLTQPVQGFPQGTW
VSEGMYPPLMPPTEQDLTKLLLEGQGEGGGSIGTQPLLQPSSYGQSGISMSHLDLRTNPS
W
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgtggagtctagtttccaagatgtccccagaaaaactgcaacggctctatgtt
gactttccacaacacctgcggcatcttctggccgaatggctggagaatcagccctgggag
ttcctggttggttcagatgctttctgttacaacatggctagtgccctactttctgccact
gtccagcgtcttcaggcctctgcaggagagcaggggaaaggaagcagcctcttgcagcac
atcagcaccttggagagcatctatcagagggaccccctgaagctggtggccaccatcaga
caaatacttcaaggggagaaaaaagctgttatagaagagttccaccacctgccagggccc
ttccatcgaaagcaggaagaactcaagtttactacagccctgggcaggcttcagcaccga
gtaagggagaccaggattctccgagaatctctgcagcaggggaccaagactgcgcaagtg
tctctgaagaacttgatagaccctcctgccaatggcactggtccaagtgaggatctggcc
acgatgctgcaggggactgtgggggacttggaggccacccaggctctagtgctgaaaagg
attcagatttggaagcggcaacagcagctggcagggaatggcacaccctttgaggagagc
ctggcagggctgcaggagaggtgtgaaagcctggtggaaatttattcccagctgcagcag
gagattggagcagccagtggggagcttgagcccaagacccgggcatcgctcataagccgt
ctggatgaagtcctgcgaacccttgtgaccagctctttcctggtggagaagcagccccca
caggttctgaagacacagactaagtttcaggctggggttcgattcctactgggtctgcag
ttcctagggacctcagccaagcctccactggtcagagctgacatggtgacagagaaacag
gccagagaactaagcctgccccaggggtctggggctggagtggagagcacaggagagatc
atgaacaatactgtacctctggagaacagtgttcctgggaactgctgctctgccctcttc
aagaacctgctcctgaagaaaatcaagcgctgtgagcggaagggtacagagtctgtcacc
gaagagaagtgcgctgtgctcttctctacgagcttcatgctgggccccaacaaacacctc
atccagcttcaggccctgtctctgcccttggtggtcatcgttcatggcaaccaagacaac
aatgccaaagctaccatcctgtgggataatgccttctctgagatggaccgagtgcccttt
gtggtagctgagcgagtgccctgggagaaaatgtgtgaaactctgaacctcaagtttatg
gctgaggtggggaccagccggggactgctaccagaacacttcctgttcctggcccagaag
atcttcaatgacaacagccttagcatagaggcctttcagcaccgctgtgtgtcttggtca
cagttcaacaaggagattctactgggccgaggcttcactttttggcagtggtttgatggt
gtcctggacctcactaaacgctgtcttcggagctactggtcagatcggctgatcatcggc
tttatcagtaagcaatatgtcactagccttctcctcaacgagccagatggaaccttcctc
ctccgctttagcgactctgagattgggggcatcaccattgcccatgtcatccggggtcag
gatggctcctcacagatagagaacatccagccgttttctgccaaagacctatccattcgc
tcactgggggaccgaatccgagatcttgctcaattaaaaaacctctaccccaagaaaccc
aaggatgaggcttttcggagccactataagccggaacagatgggaaaggacgggaggggt
tatgtctcaactactatcaagatgactgtggaaagggaccagccccttcctactccagag
ccccagatgcctgccatggtggccccttatgatcttggaatggcccctgatgcttccatg
caactcagctcagatatggtgtatcctccacagtctcattccatccactcatttcagagc
atccccctagaagagtccatgagtgtactgccaccctttcaggagcctcacctccaaatg
ccccccaccatgagccagataagcatgccctttgaccagcctcatccccagggcctgctc
cagtgccagtcccaggagcatgcggtgtccagccctgaacccttgctgtgttcagatgtc
actatggcggaagacagctgcctaactcagcctgtgcaaggtttcccccagggcacctgg
gtcagcgaaggcatgtaccctcccctgatgcctcccactgaacaggacctcaccaagctt
ctcctagagggccaaggggaaggtggaggatccatagggactcagcccctcctgcaacca
tcttcttatgggcaatcggggatctcaatgtcccacctggacctaaggaccaaccccagt
tggtga

DBGET integrated database retrieval system