KEGG   Rattus norvegicus (rat): 362912
Entry
362912            CDS       T01003                                 

Gene name
Derl1
Definition
(RefSeq) derlin-1
  KO
K11519  Derlin-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    362912 (Derl1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    362912 (Derl1)
   05022 Pathways of neurodegeneration - multiple diseases
    362912 (Derl1)
SSDB
Motif
Pfam: DER1 DUF3341
Other DBs
NCBI-GeneID: 362912
NCBI-ProteinID: NP_001014224
RGD: 1311835
Ensembl: ENSRNOG00000005551
UniProt: Q5RKH9
Position
7
AA seq 251 aa
MSDIGDWFRSIPAITRYWFAATVAVPLIGKLGIISPAYFFLWPEAFLYRFQIWRPFTATF
YFPVGPGTGFLYLVNLYFLYQYSTRLEAGAFDGRPADYLFMLLFNWICIVITGLAMDMQL
LMIPLIMSVLYVWAQLNRDLIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVG
HLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRH
NWGQGFRLGDQ
NT seq 756 nt   +upstreamnt  +downstreamnt
atgtcggacatcggggactggttcaggagcatcccggccatcacgcgctactggtttgct
gccaccgtcgcggtccccttgatcggcaagctcggtattatcagcccggcctacttcttc
ctctggcccgaagccttcctctatcgcttccagatatggaggccgttcactgccaccttt
tatttccccgtggggcccggaactggatttctttatttggtcaatttatatttcttatat
cagtattctacacggcttgaggcaggagcttttgacgggaggccagcagactatttattc
atgcttctcttcaactggatctgcattgttattactggcttagccatggatatgcagttg
ctgatgattcctctaatcatgtcagtactttacgtctgggcccagctgaacagagacctg
attgtatcattttggtttggaacacgatttaaggcctgttacttaccttgggttatcctc
ggattcaactatatcattggaggctcggtcatcaatgagctcattggaaaccttgtcgga
catctttatttcttcctgatgttcagatacccaatggatttgggaggaaggaattttctg
tccacacctcagtttttgtaccgctggctacccagcaggagaggaggggtgtcaggcttc
ggtgtgccccctgcaagcatgaggcgagctgctgatcagaatggcggaggtgggagacac
aactggggccagggcttccgacttggagaccagtga

DBGET integrated database retrieval system