KEGG   Rattus norvegicus (rat): 362918Help
Entry
362918            CDS       T01003                                 

Gene name
Mtss1
Definition
(RefSeq) MTSS1, I-BAR domain containing
  KO
K20128  metastasis suppressor protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    362918 (Mtss1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   I-BAR proteins
    362918 (Mtss1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMD WH2 Josephin DUF501
Motif
Other DBs
NCBI-GeneID: 362918
NCBI-ProteinID: NP_001124035
RGD: 1309883
Ensembl: ENSRNOG00000009001
UniProt: D3ZYM5
Position
7q33
AA seq 790 aa AA seqDB search
MGFAVSVMGTPRPRAQCSRPESVSCPRRAGKMEAVIEKECSALGGLFQTIISDMKGSYPV
WEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSI
EAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQK
KAKKVDAQGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPV
IEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQVILDLKGSDYSWSYQTPPSSPST
TMSRKSSVCSSLNSVNSSDSRSSGSHSHSPSSHYRYRSSNLAQQAPVRLSSVSSHDSGFI
SQDAFQSKSPSPMPPEAANQLSNGFSHYSLSSESHAGPVGAGPFPHCLPASRLLPRVTSI
HLPDYAHYYTIGPGMFPSSQIPSWKDWAKPGPYDQPLVNTLQRRKEKREADSSGGGPTAT
AGPPAAAEEAQRPRSMTVSAAPRPGEDMEACDELALALSRGLQLDAQRSSRDSLQCSSGY
STQTTTPCCSEDTIPSQVSDYDYFSVSGDQEAEQQEFDKSSTIPRNSDISQSYRRMFQAK
RPASTAGLPTTLGPAMVTPGVATIRRTPSTKPSVRRGTIGAGPIPIKTPVIPVKTPTVPD
LPGVLPSPPDGPEERGEHSPESPSVGEGPQGVSNIPSSLWSGHAPINPPLPGPKPSIPEE
HRQAIPESEAEDQERDPSSTSVSPGPIPESDPADLSPRESPQGEDMLNAIRRGVKLKKTT
TNDRSAPRFS
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgggctttgccgtttccgtcatgggcaccccccggccccgtgcgcagtgcagccgcccc
gagagcgtgtcctgtccccgccgcgccgggaaaatggaggctgtgatcgagaaggaatgc
agcgcgctcggaggcctcttccagaccatcatcagcgacatgaaggggagctatccagtt
tgggaagacttcataaacaaagcagggaagcttcagtcccagcttcggacaacagtagta
gcagcagctgccttcttggacgcctttcagaaagtggctgacatggccaccaacacacgt
ggtggtacccgggagatcggctcagcgctcaccagaatgtgcatgcgacacaggagcatc
gaggccaagctaaggcagttctccagcgctctgatcgattgcctgataaacccactacaa
gaacagatggaggagtggaagaaagtggccaaccagctggacaaggaccacgcaaaagaa
tataagaaagctcgccaagagataaaaaagaagtcctctgacacgctgaaactgcagaag
aaggccaaaaaagtggacgctcaggggagaggtgacatccagcctcagttggacagcgct
ctccaggatgtcaacgataaatatctcctcctggaggaaacagaaaagcaggctgtgcgc
aaagcactgatcgaagaacgtggccggttctgcaccttcatttctatgctgcggccagtg
attgaggaagagatttccatgttaggagaaattacccaccttcagaccatatcagaagat
ctgaagagcctgaccatggaccctcacaaactgccctcctcgagtgaacaggtgattctg
gacttgaaaggttctgattacagctggtcctatcagacgccaccttcttcccccagcaca
accatgtccagaaagtcaagtgtctgcagcagcctgaacagtgtcaacagcagtgactcc
cggtccagcggttcccattcgcattcccccagctcgcattaccgatatcgcagctccaac
ctggcccagcaggcccctgtgaggctgtccagcgtgtcctcccacgactcaggatttata
tcccaggacgccttccagtccaagtccccctctcccatgccacctgaggctgccaaccag
ttgtctaatgggttttctcactatagtttatcaagtgagtcccatgcagggcccgtgggt
gcaggccctttccctcattgcctgcctgcctcccgcctgctccctcgggtcacctctatc
caccttcctgactacgctcattattacaccattgggcccggcatgttcccgtcatctcag
atccctagctggaaggactgggcaaagccaggaccctacgaccagccactggtgaacact
ctccagcgccgcaaagagaagcgcgaggcggactccagtgggggaggccccacggccaca
gcaggtccacctgcagctgctgaagaggcacagagacccaggagcatgaccgtgtcagcc
gcccccaggcctggcgaggatatggaggcctgtgatgaactggccctcgccctgtcacgg
ggcctccagctggacgcgcagaggagcagccgggactcactacagtgctccagcggctat
agcacccagaccaccaccccgtgctgctcggaggataccatcccctcccaagtttcagat
tacgattatttctctgtaagtggtgaccaggaggcagagcagcaggaatttgacaagtcc
tccaccattccaaggaacagtgacatcagccagtcttacaggcggatgttccaagccaag
cgtccggcctcaacggctggccttcccaccactcttggacctgctatggtcacaccaggg
gttgcgaccatccgaaggaccccttccaccaagccttctgttcgccgggggaccattgga
gctggtcctattcctatcaagacaccagtgatccctgtcaaaaccccaactgtcccagac
ctccctggggttttgccatcccctccagatgggccagaggagaggggtgagcacagccct
gagtctccatctgtgggggagggaccccagggtgtcagcaatataccctcttccttgtgg
agtggccatgcgccgatcaaccctccacttccaggcccaaagcccagtatacctgaggag
cacagacaagcaattccagagagcgaggctgaagaccaggaaagagacccctcaagcacc
agtgtctccccaggcccgattccagagagtgacccagcagacctgagcccaagggaaagc
cctcagggagaagacatgctgaacgccatccggaggggagtgaagctgaagaagacgacc
accaacgatcgctcagcccctcgcttctcttag

DBGET integrated database retrieval system