KEGG   Rattus norvegicus (rat): 362919
Entry
362919            CDS       T01003                                 

Gene name
Washc5
Definition
(RefSeq) WASH complex subunit 5
  KO
K18464  WASH complex subunit strumpellin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    362919 (Washc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    362919 (Washc5)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Others
   WASH complex
    362919 (Washc5)
SSDB
Motif
Pfam: Strumpellin GcpE DUF3106
Other DBs
NCBI-GeneID: 362919
NCBI-ProteinID: XP_002729862
RGD: 1564420
Ensembl: ENSRNOG00000009739
UniProt: F1M1B3
Position
7
AA seq 1159 aa
MLDFLAENNLCGQAILRIVSCGNAIIAEVLRLSEFIPAVFLLKDRADQQRYGDIIFDFSY
FKGPEFWESKLEARPELQDLDEEFRENNIEIVTRFYLAFQSVHKYIVDLNRYLDDLNEGV
YIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSAD
SNLDDICKLLRSTGYSSQPGAKRPPSYPESYFQRVPINPTFISMAIGRLRSDDIYNQVSA
YPLPEHRSTALANQAAMLYVILYFEPSILHTHQAKMREIVDKYFPDNWVISIYMGITVNL
ADAWEPYKAAKTALNNTLDLPNVKEQASRYASVSERVRAQVQQFLKEGYLREEVLLDNIP
RLLNCLRDCNVAIRWLMLHTADSACDPNNKRLRQIKDQILADSRYNPKILFQLLLDTAQF
EFILKEMFKQMLSEKQSKWEHYKKEGSERMIELADVFSGVKPLTRVEKNENLQAWFREIS
KQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINI
KEEVLITMQIVGDLSFAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRI
NQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPTRLDKDK
LRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAF
ALHRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEVSRIINY
NVEQECNNFLRTKIQDWQSIYQSTHIPIPKFAPVDESITFIGRLCREILRITDPKVTCYI
DQLNTWYDMKTRQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSMFQKIIL
RERTVQETLKTLMNAVSPLRSIVANSSKVYLAAITKTQKIWSTYLEAIMKVGQMQILRRQ
IANELNSSCRFDSRHLAAALDNLNKALLADIEAHYRDPSLPYPKEDNTLLYEITAYLEAA
GIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNLGMVCRKPADPVDWPPLVLGL
LTLLKQFHSRYTEQFLALIGQFIRSTMEQCTSQKMPEMPADAVGALLFLEDYVRYTKLPR
RVAEAHVPNFIFDEFRTVL
NT seq 3480 nt   +upstreamnt  +downstreamnt
atgttggatttcctggctgagaataatctctgtggccaggcaatcctgaggattgtttcc
tgtggcaacgccatcattgccgaggtgctgcggctctctgagtttattcctgctgtgttc
ctgctgaaagaccgggctgaccagcagagatatggagacatcatcttcgacttcagctat
tttaagggtccagagttctgggaaagcaaactggaagccagacctgagctacaggattta
gatgaggaatttcgggaaaacaacatagaaattgtgaccagattttacttagcctttcaa
agtgtgcataaatacattgtagacttaaacagatacctcgatgatctcaatgaaggagtt
tatattcagcaaaccttagaaacggtgcttctcaatgaggatgggaaacaacttctatgt
gaagccctgtacttatacggagttatgctgcttgtcatcgaccagaagattgaaggagaa
gtcagagagagaatgctggtttcttactatcgatacagtgctgctcgatcctctgctgac
tcaaatctggatgatatctgtaagctactgcgaagcacggggtattccagccagccagga
gccaaaaggccacccagctaccctgaaagctatttccagagagtgcctatcaacccgacc
ttcattagcatggccatcggacgcctgcgatcggatgacatctacaaccaggtctcggcc
taccctttgccagagcaccgcagcactgccctggcgaatcaagccgccatgctgtacgtg
attctctactttgagccttccattcttcacacccaccaagcaaaaatgagagagatcgtg
gataagtactttccagataactgggtaatcagcatttatatgggtatcaccgttaatcta
gccgatgcgtgggaaccttacaaagctgcaaaaactgctttgaacaatacccttgacctc
ccaaatgtcaaagagcaggcaagcagatacgctagtgtcagcgaaagagttcgcgcccag
gtacagcagtttctgaaagagggctacttgagggaggaggtgcttctggacaatatcccc
agactgctgaactgcctgagagactgcaatgtggccatccgctggctgatgcttcacaca
gccgactcagcctgtgacccaaacaacaagcgccttcgtcaaatcaaggaccagattctg
gcagactctaggtacaatcccaagatcctcttccagctgctgctggacactgcacaattt
gagtttatactcaaagagatgttcaagcaaatgctttcagagaaacaatccaagtgggag
cattacaagaaggagggctccgagcggatgatagagctcgctgatgtcttttcaggggtg
aagccactaacccgagtggagaaaaatgaaaatcttcaagcttggttcagagagatctca
aaacaaatactgtctctaaattatgatgattctactgctgcaggcaggaaaactgtgcaa
ctaatacaagctttggaagaggttcaggagtttcaccagttggaatcaaatctacaagtt
tgccagtttcttgctgacacccggaagtttctccatcaaatgatcagaactatcaacatc
aaagaggaagtcctgatcacaatgcagattgtgggggacctttcttttgcctggcagtta
attgacagtttcacatccatcatgcaagaaagcataagggtaaatccatccatggttacc
aaactcagagccacgttcctaaagcttgcctctgcccttgaccttcccctgctacgtatc
aatcaagccaacagccctgacctcctcagcgtgtctcagtattactcaggagagttggtg
tcgtacgtgagaaaggttttgcagatcattccagaaagcatgttcacatctctcctgaag
atcataaagcttcagacccatgacatcattgaagtgcctactcgcctggacaaggacaag
ctgcgggactatgctcagctcggcccacgatacgaggtcgccaaacttactcatgccatc
tccatctttaccgagggcatcttgatgatgaaaacaaccctggtgggcatcatcaaggtg
gatcccaagcagttgctggaggacggaataaggaaagagctggttaagcgcgtggctttc
gccctccatcggggactgatattcaaccctcgtgccaagccaagtgagttgatgcccaag
ctgaaagagctgggggccaccatggatggattccatcgttcctttgagtatatacaggac
tatgtcaacatttacggcctgaagatctggcaggaggaagtgtctcgtattataaattat
aatgtggaacaagagtgtaataacttcttaagaacaaagattcaagactggcaaagtatc
taccagtccactcatattccaatcccgaagttcgcacctgtggatgagtctataacgttt
attggtcgactctgcagagaaatcttgcggatcacagacccaaaagtgacatgttacata
gaccagctgaacacttggtatgacatgaaaactcgtcaagaagtgaccagcagtcgcctc
ttctcagaaatccagaccaccttggggacttttggtctgaatggattggacaggcttctg
tgcttcatgattgtaaaagaactacagaatttcctcagtatgtttcagaaaatcatcctg
agagagagaactgttcaagaaactttaaaaacactcatgaatgctgtcagccctctaaga
agcatagtagcaaattcaagtaaagtttatcttgctgccatcacgaaaacacagaagatc
tggagcacttacctggaggctataatgaaggttggacagatgcagatcctcagacgacag
atcgccaatgagctgaactcttcctgtcgatttgattccagacatctggcagctgctctg
gacaatctcaataaggctctcctggccgacatcgaagctcactatcgggatccttcgctt
ccttaccccaaagaagataacacactcttatatgaaatcacagcctatctggaggcagct
ggcattcacaacccactgaataagatttacataacaacgaagcgcctaccctacttcccg
atcgtcaactttctgtttttgattgcacagttgccaaaacttcagtataacaaaaatcta
ggcatggtctgccggaaacctgccgaccctgtggactggccaccactcgtcctgggtctg
ctcactctgctgaagcagttccactcccggtacacagagcagttcctggcactgattggc
cagtttattcgctccacaatggagcagtgcacaagccagaagatgcctgaaatgcctgca
gatgctgtgggtgcccttctgttcctggaggattatgttcggtacacgaaactcccccga
agggtggctgaagcgcatgtgcctaacttcatttttgatgaattccgaacagtcctgtga

DBGET integrated database retrieval system