KEGG   Rattus norvegicus (rat): 362919Help
Entry
362919            CDS       T01003                                 

Gene name
RGD1564420
Definition
(RefSeq) similar to Hypothetical protein MGC31278
  KO
K18464  WASH complex subunit strumpellin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    362919 (RGD1564420)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    362919 (RGD1564420)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   WASH complex
    362919 (RGD1564420)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Strumpellin EF-hand_9 GcpE DUF3106
Motif
Other DBs
NCBI-GeneID: 362919
NCBI-ProteinID: XP_002729862
RGD: 1564420
Ensembl: ENSRNOG00000009739
UniProt: F1M1B3
Position
7q33
AA seq 1159 aa AA seqDB search
MLDFLAENNLCGQAILRIVSCGNAIIAEVLRLSEFIPAVFLLKDRADQQRYGDIIFDFSY
FKGPEFWESKLEARPELQDLDEEFRENNIEIVTRFYLAFQSVHKYIVDLNRYLDDLNEGV
YIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSAD
SNLDDICKLLRSTGYSSQPGAKRPPSYPESYFQRVPINPTFISMAIGRLRSDDIYNQVSA
YPLPEHRSTALANQAAMLYVILYFEPSILHTHQAKMREIVDKYFPDNWVISIYMGITVNL
ADAWEPYKAAKTALNNTLDLPNVKEQASRYASVSERVRAQVQQFLKEGYLREEVLLDNIP
RLLNCLRDCNVAIRWLMLHTADSACDPNNKRLRQIKDQILADSRYNPKILFQLLLDTAQF
EFILKEMFKQMLSEKQSKWEHYKKEGSERMIELADVFSGVKPLTRVEKNENLQAWFREIS
KQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINI
KEEVLITMQIVGDLSFAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRI
NQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPTRLDKDK
LRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAF
ALHRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEVSRIINY
NVEQECNNFLRTKIQDWQSIYQSTHIPIPKFAPVDESITFIGRLCREILRITDPKVTCYI
DQLNTWYDMKTRQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSMFQKIIL
RERTVQETLKTLMNAVSPLRSIVANSSKVYLAAITKTQKIWSTYLEAIMKVGQMQILRRQ
IANELNSSCRFDSRHLAAALDNLNKALLADIEAHYRDPSLPYPKEDNTLLYEITAYLEAA
GIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNLGMVCRKPADPVDWPPLVLGL
LTLLKQFHSRYTEQFLALIGQFIRSTMEQCTSQKMPEMPADAVGALLFLEDYVRYTKLPR
RVAEAHVPNFIFDEFRTVL
NT seq 3480 nt NT seq  +upstreamnt  +downstreamnt
atgttggatttcctggctgagaataatctctgtggccaggcaatcctgaggattgtttcc
tgtggcaacgccatcattgccgaggtgctgcggctctctgagtttattcctgctgtgttc
ctgctgaaagaccgggctgaccagcagagatatggagacatcatcttcgacttcagctat
tttaagggtccagagttctgggaaagcaaactggaagccagacctgagctacaggattta
gatgaggaatttcgggaaaacaacatagaaattgtgaccagattttacttagcctttcaa
agtgtgcataaatacattgtagacttaaacagatacctcgatgatctcaatgaaggagtt
tatattcagcaaaccttagaaacggtgcttctcaatgaggatgggaaacaacttctatgt
gaagccctgtacttatacggagttatgctgcttgtcatcgaccagaagattgaaggagaa
gtcagagagagaatgctggtttcttactatcgatacagtgctgctcgatcctctgctgac
tcaaatctggatgatatctgtaagctactgcgaagcacggggtattccagccagccagga
gccaaaaggccacccagctaccctgaaagctatttccagagagtgcctatcaacccgacc
ttcattagcatggccatcggacgcctgcgatcggatgacatctacaaccaggtctcggcc
taccctttgccagagcaccgcagcactgccctggcgaatcaagccgccatgctgtacgtg
attctctactttgagccttccattcttcacacccaccaagcaaaaatgagagagatcgtg
gataagtactttccagataactgggtaatcagcatttatatgggtatcaccgttaatcta
gccgatgcgtgggaaccttacaaagctgcaaaaactgctttgaacaatacccttgacctc
ccaaatgtcaaagagcaggcaagcagatacgctagtgtcagcgaaagagttcgcgcccag
gtacagcagtttctgaaagagggctacttgagggaggaggtgcttctggacaatatcccc
agactgctgaactgcctgagagactgcaatgtggccatccgctggctgatgcttcacaca
gccgactcagcctgtgacccaaacaacaagcgccttcgtcaaatcaaggaccagattctg
gcagactctaggtacaatcccaagatcctcttccagctgctgctggacactgcacaattt
gagtttatactcaaagagatgttcaagcaaatgctttcagagaaacaatccaagtgggag
cattacaagaaggagggctccgagcggatgatagagctcgctgatgtcttttcaggggtg
aagccactaacccgagtggagaaaaatgaaaatcttcaagcttggttcagagagatctca
aaacaaatactgtctctaaattatgatgattctactgctgcaggcaggaaaactgtgcaa
ctaatacaagctttggaagaggttcaggagtttcaccagttggaatcaaatctacaagtt
tgccagtttcttgctgacacccggaagtttctccatcaaatgatcagaactatcaacatc
aaagaggaagtcctgatcacaatgcagattgtgggggacctttcttttgcctggcagtta
attgacagtttcacatccatcatgcaagaaagcataagggtaaatccatccatggttacc
aaactcagagccacgttcctaaagcttgcctctgcccttgaccttcccctgctacgtatc
aatcaagccaacagccctgacctcctcagcgtgtctcagtattactcaggagagttggtg
tcgtacgtgagaaaggttttgcagatcattccagaaagcatgttcacatctctcctgaag
atcataaagcttcagacccatgacatcattgaagtgcctactcgcctggacaaggacaag
ctgcgggactatgctcagctcggcccacgatacgaggtcgccaaacttactcatgccatc
tccatctttaccgagggcatcttgatgatgaaaacaaccctggtgggcatcatcaaggtg
gatcccaagcagttgctggaggacggaataaggaaagagctggttaagcgcgtggctttc
gccctccatcggggactgatattcaaccctcgtgccaagccaagtgagttgatgcccaag
ctgaaagagctgggggccaccatggatggattccatcgttcctttgagtatatacaggac
tatgtcaacatttacggcctgaagatctggcaggaggaagtgtctcgtattataaattat
aatgtggaacaagagtgtaataacttcttaagaacaaagattcaagactggcaaagtatc
taccagtccactcatattccaatcccgaagttcgcacctgtggatgagtctataacgttt
attggtcgactctgcagagaaatcttgcggatcacagacccaaaagtgacatgttacata
gaccagctgaacacttggtatgacatgaaaactcgtcaagaagtgaccagcagtcgcctc
ttctcagaaatccagaccaccttggggacttttggtctgaatggattggacaggcttctg
tgcttcatgattgtaaaagaactacagaatttcctcagtatgtttcagaaaatcatcctg
agagagagaactgttcaagaaactttaaaaacactcatgaatgctgtcagccctctaaga
agcatagtagcaaattcaagtaaagtttatcttgctgccatcacgaaaacacagaagatc
tggagcacttacctggaggctataatgaaggttggacagatgcagatcctcagacgacag
atcgccaatgagctgaactcttcctgtcgatttgattccagacatctggcagctgctctg
gacaatctcaataaggctctcctggccgacatcgaagctcactatcgggatccttcgctt
ccttaccccaaagaagataacacactcttatatgaaatcacagcctatctggaggcagct
ggcattcacaacccactgaataagatttacataacaacgaagcgcctaccctacttcccg
atcgtcaactttctgtttttgattgcacagttgccaaaacttcagtataacaaaaatcta
ggcatggtctgccggaaacctgccgaccctgtggactggccaccactcgtcctgggtctg
ctcactctgctgaagcagttccactcccggtacacagagcagttcctggcactgattggc
cagtttattcgctccacaatggagcagtgcacaagccagaagatgcctgaaatgcctgca
gatgctgtgggtgcccttctgttcctggaggattatgttcggtacacgaaactcccccga
agggtggctgaagcgcatgtgcctaacttcatttttgatgaattccgaacagtcctgtga

DBGET integrated database retrieval system