KEGG   Rattus norvegicus (rat): 362962Help
Entry
362962            CDS       T01003                                 

Gene name
Cbx7
Definition
(RefSeq) chromobox 7
  KO
K11454  chromobox protein 7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    362962 (Cbx7)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     362962 (Cbx7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chromo CBX7_C Mtf2_C MotY_N
Motif
Other DBs
NCBI-GeneID: 362962
NCBI-ProteinID: NP_954548
RGD: 735027
Ensembl: ENSRNOG00000016875
UniProt: P60889
Position
7q34
AA seq 158 aa AA seqDB search
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EEKDRASGYRKRGPKPKRLLLQESAAPDVLQATGDWEPVEQPPEEEAEADLTNGPPPWTP
MLPSSEVTVTDITANSVTVTFREAQAAEGFFRDRSGKL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtcagccataggcgagcaggtgtttgcggtggagagcatccggaagaagcgc
gtgcggaagggcaaagttgaatatctggtgaagtggaaaggatggccccccaaatacagc
acatgggaaccagaggagcacattctggaccctcgccttgtcatggcctacgaggagaag
gaggagaaagaccgagcatcagggtataggaagagaggtccgaaacccaagcggcttctg
ctgcaggaatcagcagcgccagatgtcctgcaggccactggagactgggagcctgtggag
cagccccctgaagaggaggcagaagcagacctgaccaatgggccgcctccctggacgccc
atgctcccctcaagtgaagttaccgtgactgacatcaccgccaactccgtcacagtcacc
ttccgcgaggctcaagccgccgagggcttcttccgagaccgcagtgggaagctgtga

DBGET integrated database retrieval system