KEGG   Rattus norvegicus (rat): 362969Help
Entry
362969            CDS       T01003                                 

Gene name
Ttll1
Definition
(RefSeq) tubulin tyrosine ligase like 1
  KO
K16599  tubulin polyglutamylase TTLL1 [EC:6.-.-.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    362969 (Ttll1)
Enzymes [BR:rno01000]
 6. Ligases
  6.-  
   6.-.-  
    6.-.-.-  
     362969 (Ttll1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Tubulin modification proteins
     Tubulin polyglutamylases
      362969 (Ttll1)
     Tubulin polyglutamylase complex components
      362969 (Ttll1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TTL ATPgrasp_YheCD ATPgrasp_ST
Motif
Other DBs
NCBI-GeneID: 362969
NCBI-ProteinID: NP_001012200
RGD: 1309124
Ensembl: ENSRNOG00000010141
UniProt: Q5PPI9
Position
7q34
AA seq 423 aa AA seqDB search
MAGRVKWVTDIEKSVLINNFEKRGWVQVTENEDWNFYWMSVQTIRNVFSVETGYRLSDDQ
IVNHFPNHYELTRKDLMVKNIKRYRKELEKEGSPLAEKDENGKYLYLDFVPVTYMLPADY
NLFVEEFRKSPSSTWIMKPCGKAQGKGIFLINKLSQIKKWSRDSKTSSFVSQSTKEAYVI
SLYINNPLLIGGRKFDLRLYVLVSTYRPLRCYMYKLGFCRFCTVKYTPSTSELDNMFVHL
TNVAIQKHGEDYNHIHGGKWTVNNLRLYLESTRGREVTSKLFDEIHWIIVQSLKAVAPVM
NNDKHCFECYGYDIIIDDKLKPWLIEVNASPSLTSSTANDRILKYNLINDTLNIAVPNGE
IPDCKWNKSPPKEVLGNYEILYDEELAQGDGAERELRSRPGQPVGPRTGRSRDSGRNVLT
TWK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaagggtgaagtgggtcactgacattgagaagtcggtcctaatcaacaacttt
gagaagagagggtgggtccaagtgacagaaaatgaagattggaatttttactggatgagc
gtgcagaccattcgcaacgtgttcagcgtagagactgggtacaggctctcagacgaccag
atcgtcaaccatttccccaaccactatgagctgacccgcaaggacctgatggtgaagaac
attaagagatacaggaaggaactggagaaggaaggaagtcccctggcggagaaagacgag
aatgggaaatacctctatctggacttcgttccggtcacctacatgctccccgctgactac
aacctgtttgtggaagaattccggaagagcccatccagcacctggatcatgaagccatgc
ggcaaagcccagggaaagggcatcttcctcatcaacaagctctcacagatcaaaaagtgg
tctcgggatagcaagacatcctcgtttgtgtcccagtccacaaaagaagcgtacgtgatc
tcactctatatcaataatccactgctcatcggtgggaggaagtttgaccttcgtctgtat
gtcctggtttccacataccgcccgctgcgctgctacatgtacaagcttgggttctgccgc
ttctgcacagtgaagtacactccaagcactagtgagctagacaacatgttcgtccacctt
accaatgtagccatccagaagcacggggaggactacaaccacatccatggtggcaagtgg
actgtcaacaacctgcgtctctacctggagagtacccgaggccgcgaggtgaccagcaaa
ctgtttgatgaaatacactggatcattgtgcagtctctcaaggctgtggcacctgtgatg
aacaacgacaagcactgctttgaatgctacggctacgacatcatcatcgacgacaagctg
aagccctggctgatcgaggttaacgcgtccccatctctcacctccagcaccgccaatgat
cggatccttaagtacaacctgattaacgacaccctcaacattgcggtccctaacggcgag
attccagactgcaaatggaacaagtctccccctaaggaagtgcttggcaactatgagatc
ctgtatgacgaggagctggcccagggtgacggggctgaacgagagcttagaagtcgccca
ggtcagccagtggggcccagaacaggccgctcgagagactcaggaagaaatgtcctcaca
acctggaagtga

DBGET integrated database retrieval system