KEGG   Rattus norvegicus (rat): 363013Help
Entry
363013            CDS       T01003                                 

Gene name
Tmem123, RGD1305625
Definition
(RefSeq) transmembrane protein 123
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: MGC-24 DAP10
Motif
Other DBs
NCBI-GeneID: 363013
NCBI-ProteinID: NP_001014227
RGD: 1305625
Ensembl: ENSRNOG00000010584
UniProt: Q5HZB0
Position
8q11
AA seq 194 aa AA seqDB search
MALCARAALLLGALQVLALPGAVAQETYAQGSPSGNHSVPLLTANVNVTENTTMQVVSNQ
TSQISTVKPSSVLPKNVTAATVRPATIKVSTPGVSPHVTPSASKSTPKTSASPNSTQTSA
SMTTTAHSSLLTSVTVSATTHPTKGKGSKFDAGSFVGGIVLTLGVLSILYIGCKMYYSRR
GIRYRSIDEHDAII
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgtgtgcgcgggccgcgctgcttctgggcgcgctgcaggtgctggcgctgccc
ggggccgtggcgcaggagacctatgctcagggctctccaagtggaaaccactctgtgcct
ctgctgactgccaatgttaatgtgacagagaataccaccatgcaagtggtttccaaccag
accagtcagattagcactgtgaagccgtcttcagtgttgccaaaaaatgtcacagctgcc
actgtgaggcctgcaactattaaagtatcaaccccgggagtctctccacatgtgaccccc
agtgcctcaaagtcgacacccaaaacaagtgcttccccaaactccacccagacgtcagca
tccatgacaaccacagcccacagtagtttactgacatctgtaacggtttcagcaaccact
catcccaccaaaggcaaaggatcaaagtttgacgccggcagctttgttggtggtatagtg
ttaacactgggagttttgtctattctctacattggatgcaaaatgtattactcaagaaga
ggcattcgctatcgaagcattgatgaacatgatgctatcatttaa

DBGET integrated database retrieval system