KEGG   Rattus norvegicus (rat): 363014
Entry
363014            CDS       T01003                                 

Gene name
Yap1
Definition
(RefSeq) transcriptional coactivator YAP1
  KO
K16687  transcriptional coactivator YAP1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04390  Hippo signaling pathway
rno04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    363014 (Yap1)
   04392 Hippo signaling pathway - multiple species
    363014 (Yap1)
SSDB
Motif
Pfam: WW FAM181
Other DBs
NCBI-GeneID: 363014
NCBI-ProteinID: NP_001029174
RGD: 1306035
Ensembl: ENSRNOG00000005933
UniProt: Q2EJA0
Position
8
AA seq 366 aa
MEPAQQPPPQPAPQGPAPPSVSPAGTPAAPPAPPAGHQVVHVRGDSETDLEALFNAVMNP
KTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLG
AGTLTASGVVSGPAATPAAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHNDQTTT
WQDPRKAMLSQLNVPTSASPAVPQTLMNSASGPLPDGWEQAMTQDGEVYYINHKNKTTSW
LDPRLDPRFAMNQRITQSAPVKQPPPLAPQSPQGGVLGGGSSNQQQQIQLQQLQMEKERL
RLKQQELFRQAIRNINPSTANAPKCQTVRAGISSPQPVALTGAGWRDSECSVFSRDDSGI
EDNDNQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggagcccgcgcaacagccgccgccccagccggccccgcaaggccccgcgccgccgtcg
gtgtctccggccgggacccccgcggccccgcccgcacccccggcgggtcaccaggtcgtg
cacgtccgcggggactcggagaccgacctggaagcgcttttcaacgccgtcatgaacccc
aagacggccaacgtgccacagaccgtgcccatgaggcttcgcaagctgcccgactccttc
ttcaagccgcctgagcccaagtcccactcgcgacaggccagtaccgatgcgggcactgct
ggagccctgactccccagcacgttcgagctcactcgtctccagcctccctgcagctgggg
gccgggacactcacggccagtggtgttgtctctggcccggccgccacccctgctgctcaa
catctcagacagtcttcctttgagatccctgatgatgtaccattgccagcaggctgggag
atggccaagacctcttctggtcagagatacttcttaaatcacaatgatcagacaacaaca
tggcaggacccccggaaggccatgctctcccaactgaacgttcctacatctgccagccca
gcagtgccccagacgctgatgaactctgcctcagggcctcttcctgatggatgggagcaa
gccatgactcaggatggagaagtttactacataaaccataagaacaagaccacatcctgg
ctggacccaaggcttgaccctcgttttgccatgaaccagaggatcactcagagtgctcca
gtgaagcagcccccacccttggctccccagagcccacagggaggcgtcctgggtggaggc
agctcaaaccagcagcagcagatacagctgcagcagctacagatggagaaggagaggctg
cgattgaaacagcaggagttatttcggcaggcaatacggaatatcaatcccagcacagca
aatgctccaaaatgtcagaccgtcagagcgggaattagctctccgcagccagttgccctc
actggagcaggatggagggactcagaatgcagtgtcttctcccgggatgactcaggaatt
gaggacaatgacaaccaatag

DBGET integrated database retrieval system