KEGG   Rattus norvegicus (rat): 363017Help
Entry
363017            CDS       T01003                                 

Gene name
Taf1d, Josd3, RGD1309627
Definition
(RefSeq) TATA-box binding protein associated factor, RNA polymerase I subunit D
  KO
K15215  TATA box-binding protein-associated factor RNA polymerase I subunit D
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    363017 (Taf1d)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase I system
   Basal transcription factors
    SL1/TIF-1B
     363017 (Taf1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TAF1D
Motif
Other DBs
NCBI-GeneID: 363017
NCBI-ProteinID: NP_001014229
RGD: 1309627
Ensembl: ENSRNOG00000010921
UniProt: Q5M948
Position
8q12
AA seq 285 aa AA seqDB search
MAQSEVDSVDCVTSDRDGDIGNQSDDSSNSSLFKTQCVPSPTRKQRIPTVKCVPSLASVE
TDSSSDSSLEPRPLTLKAIFERFKKKKRKKRKKRKYKPKLRRQGRPSGTRNIRRSQIDAK
QIKDKGAVFPFLESESGRKTLPWKKILTYEQAVARGFFHHIEKLKYEHHLKECLSQMHAG
EDLEKEDFDSRRHKYMDDDGPLSPIEEPSTEDEATDPQSECDIKLVEDSCFIISTEFPRK
RNLEQGKIKKESAFSKKSKAKDATQRGNRRSWKGGEHACLHSEVS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatcagaggtggattctgttgactgtgtgacatcggatagagatggggacatt
ggaaatcaaagtgatgactcatccaatagcagcttatttaaaacacagtgtgttccttca
cctacaagaaagcaaagaatccctactgtgaaatgtgttccttcacttgcaagtgttgaa
acagattcatcaagtgactcttctctagaaccaaggcctttgactttaaaggctattttt
gaaagatttaagaaaaagaaaaggaaaaagaggaaaaagagaaaatataagccaaagtta
agacgacaaggaagaccatctggaacgaggaacattagaaggtcacaaatagatgcaaaa
caaattaaagacaaaggagctgtgtttccattcttagaatctgaaagtggaagaaagact
ttaccttggaagaaaattttaacatatgagcaagcagttgcaagaggattttttcaccac
attgaaaaactcaagtatgaacaccaccttaaggaatgcttgagccaaatgcatgctggg
gaagatttagaaaaggaagactttgacagccgtagacacaagtacatggatgatgatggt
ccgctttctcctattgaagagccgtcaactgaagatgaagcaacagatcctcagtctgaa
tgtgatattaagttggttgaagacagttgctttataataagtacagaattcccaaggaag
agaaacttagaacaaggaaagattaagaaagaatctgcattctctaaaaagagcaaagcc
aaggatgccacacagagagggaacaggaggtcctggaaaggaggtgaacatgcttgcctt
cattctgaagtcagttaa

DBGET integrated database retrieval system