KEGG   Rattus norvegicus (rat): 363035Help
Entry
363035            CDS       T01003                                 

Gene name
Zbtb44, Btbd15, RGD1308984
Definition
(RefSeq) zinc finger and BTB domain containing 44
  KO
K10515  zinc finger and BTB domain-containing protein 44
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    363035 (Zbtb44)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     363035 (Zbtb44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_11 zf-C2H2_6 zf-met zf-C2HE zf-H2C2_5 Glyco_tran_10_N DUF3342 zf-C2H2_9
Motif
Other DBs
NCBI-GeneID: 363035
NCBI-ProteinID: NP_001030114
RGD: 1308984
Ensembl: ENSRNOG00000005578
UniProt: Q3SWU4
Position
8q13
AA seq 453 aa AA seqDB search
MGVKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDRIFRAHKVVLAACSDFFRTKL
VGQTEDENKNVLDLHHVTVTGFIPLLEYAYTATLSINTENIIDVLAAASYMQMFSVASTC
SEFMKSSILWNTPNSQPEKGLDAGQENSSNCNFTSRDGSISPVSSECSAVERTIPVCRES
RRKRKSYIVMSPESPVKCSTQTNSPQVLNSSASYAENRNQPVDSSLAFPWTFPFGIDRRI
QPEKAKQAENTRTLELPGPSEAGRRMADYVTCESTKTTLPLGTEEDVRVKVERLSDEEVH
EEVSQPVSASQSSLSDQQTVPGSEPVQEDLLISPQSSSIGSVDEGVTEGLPTLQSTSSTN
AHADEDDRLENVQYPYQLYIAPSTSSTERPSPNGPDRPFQCPTCGVRFTRIQNLKQHMLI
HSGIKPFQCDCCGKKFTRAYSLKMHRLKHEVIS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgaaaacatttactcacagctcctcttcccacagccaggaaatgctgggaaaa
ctaaatatgctacgaaatgacggacatttttgtgatatcactattcgtgtccaggacaga
atcttccgggctcacaaggtggtactagcagcttgcagtgatttctttcgaaccaaactt
gtgggccaaacagaggatgagaacaaaaatgtgttggatctgcatcatgttacagtgact
ggctttatacctctgctggaatacgcttacacagccactctgtccattaacacggaaaat
attattgatgttctagcagcagccagctatatgcaaatgtttagtgttgctagtacgtgc
tcagagttcatgaaatcaagtattttgtggaatacacctaatagccaaccagaaaagggt
ctagatgctggacaagaaaatagttccaactgcaattttacttctcgagatggaagcatt
tctccagtgtcttccgagtgcagtgctgtggaaaggaccattcctgtctgccgagagtcc
cggagaaaacgcaaaagctacattgttatgtctcctgagagccctgtaaaatgtagcaca
caaacaaattccccccaggtactgaattcttcagcttcctatgcagaaaatagaaatcag
ccagttgattcttctttagcgtttccatggactttcccttttggaattgataggaggatt
cagcctgagaaagcaaagcaggcagaaaatacccggactttagagttgcctggcccgtcc
gaggcaggtagaaggatggctgactatgtgacttgtgagagcacaaaaactaccttgcct
ctaggtacagaagaagacgtccgggtcaaagtagaaagattaagtgatgaggaggttcat
gaggaagtgtcccagcccgttagtgcatctcagagctcactgagtgatcagcagacggtg
cctggaagtgaaccagttcaagaggaccttctgattagtccacagtcttcctctataggc
tcagtggatgaaggagtcactgaaggattgcctacacttcagagcacttccagcaccaat
gctcatgcagatgaggatgacagattggaaaatgttcagtatccctatcaactgtacatt
gctccttctaccagcagtacagaacgaccaagtccaaatggtccagacagaccttttcaa
tgtccaacctgtggggttcgcttcacccgtattcagaatctaaaacagcacatgcttatc
cactcaggaattaaaccatttcagtgtgactgctgtggaaaaaagtttaccagggcttac
tcgctaaagatgcatcgcctaaagcacgaagtgatttcttag

DBGET integrated database retrieval system