KEGG   Rattus norvegicus (rat): 363059
Entry
363059            CDS       T01003                                 

Gene name
Zw10
Definition
(RefSeq) zw10 kinetochore protein
  KO
K11578  protein transport protein DSL1/ZW10
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    363059 (Zw10)
   03036 Chromosome and associated proteins [BR:rno03036]
    363059 (Zw10)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   NRZ (DSL1) complex
    363059 (Zw10)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     RZZ complex
      363059 (Zw10)
SSDB
Motif
Pfam: Zw10 COG5 DUF2321 Vps51 Sec8_exocyst Exonuc_VII_L Ribonuc_2-5A
Other DBs
NCBI-GeneID: 363059
NCBI-ProteinID: NP_001019972
RGD: 1309197
Ensembl: ENSRNOG00000054479
UniProt: Q4V8C2
Position
8q23
AA seq 777 aa
MASFVTEVLAHSGSLEKEDLGTRISRLTRRVEEIKGEVCNMISKKYSEFLPTMQSAQALV
TQVDTLSNDIDQLKSRIETEVCRDLHISTVEFTNLKQRLERDSVVLNLLKQLQEFSSAIE
EYNSALAEKKYIPAARLLEEAQECLKLLKSKKCFDLKMLKSLSMELTVQKQNILYHLGED
WQKLVVWKFPPSKDTSSLESCLQTELHLCTEQPEKEMTPLPSISSVLLAFSILGELPTKL
KSFGQMLLKYILKPLVTCPSLHAVIERQPNSVSICFQSLATDSEHPPPPEAFAKIQLVLE
VLQKQLLDLPLDADLEIGKVPEIVLAEMLGEVIWEDLSDCLIRNCLVYSIPTNSSKLQQY
EEIIQSTEEFEKSLKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARHLMTSEIHN
TVKIGPDCEETLPDLPSPDADHRLQVQVCKVQFTDAGNLEPETSLDPRSFSLPTCRISEA
VKKLMELAYQTLLEATTSSDQCAVQLFYSVRNIFHLFHDVVPTYHKENLQKLPQLAAIHH
NNCMYIAHHLLTLGHQFRSRLTPILCDGTTTFVDLVPGFRRLGTECFLAQMRTQKGELLE
RLSSARSFANMDDEENYSAASKAVRQVLHQLKRLGIVWQDVLPVNIYCKAMGTLLNTVIA
EMIGRITALEDISTEDGDRLYSLCKTVMDEGPQVFAPLSDENKNKKYQEEVPVYVSKWMP
FKELMIMLQASLQEIGDRWADGKGPLATAFPSSEVKALIRALFQNTERRAAALAKIK
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggcttctttcgtgacggaagtcttggcccactcggggagcctggagaaggaggatctg
ggcaccaggatcagccgtctgacccggcgggtggaggagatcaagggcgaggtgtgcaat
atgatcagcaagaagtacagtgaattcctgcctaccatgcagagcgcacaggccctcgtc
acccaggtggacactctatccaatgacatcgaccagctgaaatccaggatagagactgag
gtctgtcgggatcttcacatatcaactgttgagtttacgaacttgaagcagcggctggaa
agagactctgtcgtcctaaatttgctcaaacagctgcaagagttttcttctgctattgaa
gagtataacagtgcactggcagagaagaaatacatccctgctgctcggctcctggaggag
gcacaggaatgcttgaagttattaaaatcaaaaaaatgctttgacttaaaaatgttgaag
tctctcagcatggagctcacggtacagaagcagaacatcctttaccacctgggagaagac
tggcagaagctggttgtatggaagttcccgccatcaaaagataccagcagcttagaatct
tgtctacaaacagaacttcatttatgcactgagcagcccgagaaggagatgactcctctg
ccatccatcagctctgtcctcttggcgttttctattcttggagaattacccaccaagctg
aagtcatttggtcagatgctgctgaagtatatacttaagcctctggtgacttgcccgtcg
ctccatgctgtgattgaaaggcagccgaattcagttagcatttgtttccagtctctggcg
acggactcagaacatccaccaccacccgaagcttttgcaaagatccagttggtattggaa
gtgctccagaaacagcttctagatttgcctcttgatgctgacctagaaattggaaaagtc
cctgagatcgtgttggctgagatgcttggtgaggtgatctgggaggacctgtccgattgc
ctcatcagaaactgcttggtttactctattcccaccaatagcagcaagctacagcaatat
gaggagatcatacagtccacagaggaatttgaaaagtccctaaaagagatgagattttta
aaaggagatactactgacttgctgaaatatgctcgcaatatcaattctcattttgctaat
aagaagtgccaggatgtgattgtggcggctagacatctaatgacctccgaaattcacaac
accgtgaagattggtcctgattgtgaggaaaccctaccagacttgcccagtcctgatgcc
gaccacaggctacaagtgcaggtgtgcaaagtgcagttcaccgatgccggaaacttagag
cccgagacttcgctggaccctcggtccttctctttacccacgtgccgcatcagtgaggct
gtgaagaagttaatggagctcgcttatcagactttacttgaggcaacaacaagtagcgac
caatgtgctgtccagcttttttactcagtgagaaatatcttccatttgttccatgatgtg
gtgcccacataccacaaggagaaccttcagaagcttccccagttggctgccattcaccat
aacaactgcatgtatattgctcaccacttgctgaccctcggccatcagttcagatcgcgg
ctcacccccattctttgtgatggcacgaccacttttgtggaccttgtacctggcttcaga
agacttgggacggagtgttttttggcccagatgcggacccagaaaggagaacttctggag
agattatcaagtgctagaagctttgcaaacatggatgatgaagagaattattctgcagcg
agcaaggcagtgaggcaggtgctgcaccagctgaagagacttgggatcgtgtggcaggat
gtcctgccggtgaacatatactgcaaggctatggggaccttgctgaacaccgtgattgct
gagatgattggcaggatcactgctctagaggacatctcgactgaagatggcgatagattg
tattccctgtgcaaaacagtgatggatgaagggccacaagtatttgcacctctgtctgat
gaaaacaaaaacaagaaataccaagaagaggttccggtctatgtgtccaagtggatgcct
ttcaaagaactcatgataatgctacaagctagcttgcaggaaatcggagatcggtgggca
gatggaaaagggcccctggcaactgcattcccttccagcgaagtaaaagctttaattcgt
gccttgttccagaacacagaaagaagagcggctgcccttgctaagattaaatag

DBGET integrated database retrieval system