KEGG   Rattus norvegicus (rat): 363060
Entry
363060            CDS       T01003                                 

Gene name
Plet1
Definition
(RefSeq) placenta expressed transcript 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: RIFIN
Other DBs
NCBI-GeneID: 363060
NCBI-ProteinID: NP_001014231
RGD: 1359217
Ensembl: ENSRNOG00000024346
UniProt: Q5HZW7
Position
8q23
AA seq 255 aa
MPALRTLLPHLGLFLCLALCFSPSFSLSNNESCILYDQVYPSDNLINASAEEVSGENTTY
TVTVPVNDSVSAVILKAEKDNKPVGTWSGAYEKCNNSVVYNLTSLNNSAFQTNWTVPSSE
DVTKVNLTIFIVINRTATVSSVKLEPKETSSLASTPESQTSAMTTAMTSAMTTAKTTAVA
TNSSTDVTSDNSTAVTTANSTAVTTANSTAVTTAKTTTMTTATTTAKSLAIRTLCSPLAG
ALHILLVFLISKLLF
NT seq 768 nt   +upstreamnt  +downstreamnt
atgcctgcactccgcaccttgctgccacacctggggctgttcctgtgcctggctctgtgc
ttttccccttccttctctctcagcaataatgagtcctgcatactttacgatcaagtctac
ccctctgacaacttgatcaacgcttcagctgaggaggtctctggtgagaatacaacctac
acagtgacagtccctgtgaacgattcagtcagtgctgtgatcctgaaagctgaaaaagac
aacaaaccagtgggcacctggagcggagcatacgagaagtgcaacaacagcgttgtctac
aacttgacatctctaaacaactcagccttccagacaaactggaccgttcctagttctgag
gacgtgactaaagtcaacctgacgatcttcattgtcatcaaccgcacagctacagtgtca
tctgtgaaactggagccaaaagaaacttcaagcttggcctctactcctgagagccagacc
tcagccatgactacagccatgacctcagccatgactacagccaagactacagccgtggcc
acaaacagtagcacagacgtgacctcagacaatagcaccgccgtgaccacagccaatagc
accgccgtgaccacagccaatagcacagccgtgaccacagccaagaccacaaccatgacc
acagccacgaccacagccaaaagcctggccatccgtactctctgcagccccctggcaggc
gccctccatatcctgcttgtttttctcattagtaaactcctcttctga

DBGET integrated database retrieval system