KEGG   Rattus norvegicus (rat): 363061
Entry
363061            CDS       T01003                                 

Gene name
Sdhd
Definition
(RefSeq) succinate dehydrogenase complex subunit D
  KO
K00237  succinate dehydrogenase (ubiquinone) membrane anchor subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rno_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    363061 (Sdhd)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    363061 (Sdhd)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    363061 (Sdhd)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    363061 (Sdhd)
   05012 Parkinson disease
    363061 (Sdhd)
   05014 Amyotrophic lateral sclerosis
    363061 (Sdhd)
   05016 Huntington disease
    363061 (Sdhd)
   05020 Prion disease
    363061 (Sdhd)
   05022 Pathways of neurodegeneration - multiple diseases
    363061 (Sdhd)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    363061 (Sdhd)
SSDB
Motif
Pfam: CybS
Other DBs
NCBI-GeneID: 363061
NCBI-ProteinID: NP_942083
RGD: 735231
Ensembl: ENSRNOG00000022980
UniProt: Q6PCT8
Position
8q23
AA seq 159 aa
MAVLLKLGVLCSGQGARALSLRSRAVRPAFVSAFLQDQPTPGWRGTQHIHLSPSHQSGSK
AASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGIGQVVTDYVHGDAL
QKATKAGLLAVSALTFAGLCYFNYHDVGICRAVAMLWKL
NT seq 480 nt   +upstreamnt  +downstreamnt
atggcggttctcttaaagctgggcgttctctgcagtggccaaggagctcgagctctgtca
ctccgaagccgggcggtcagacctgcttttgtgtccgcatttctccaggaccagcctacc
ccaggatggcgtggcacccagcacatccacctgtcaccaagccaccagtctggttccaag
gccgcatctctccactggaccagtgagagggttgtcagtgttttgctcttgggcctgatt
ccagctgggtacttgaatccctgctctgtggtggactactctctggctgcagccctcacc
ctgcacagtcactggggcattggacaagtggttactgactacgttcatggggacgcactg
cagaaggctaccaaggcaggcctcttggcagtctcagctttgacctttgctgggctttgc
tacttcaattaccacgatgtaggcatctgcagagcggttgccatgctgtggaagctctga

DBGET integrated database retrieval system