KEGG   Rattus norvegicus (rat): 363062Help
Entry
363062            CDS       T01003                                 

Gene name
Dixdc1, Ccd1
Definition
(RefSeq) DIX domain containing 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DIX CH CAMSAP_CH Thiamine_BP CH_2
Motif
Other DBs
NCBI-GeneID: 363062
NCBI-ProteinID: NP_001032743
RGD: 1309902
Ensembl: ENSRNOG00000010260
UniProt: Q2VUH7
Position
8q23
AA seq 674 aa AA seqDB search
MLSSATLDETVELRAGEEPSDASLGQQLQAYVAWVNAQLKKRPSVKPVQDLRQDLRDGVI
LAYLIEIVAGEKLSGVQLSPSNQQEMKSNVERVLQFVASKNIRMHQTSAKDIVEGNLKSI
MRLVLALAAHFKPGSSRTVSQGRDSRTSVQSHQPHCATAVAQGAAAALADVCHDVSRSGR
DVFRYRQRNASVDEEIENPYWSVRALVQQYEGQQRSPSESSCSSLTSPSPIHSAKSESII
TQSEEKADFVIIPSEGIENRTDETGSPLSRDWRPGSPGTYLEATWEEQLLEQQEHLEKEM
EEAKKMISGLQALLLNGSLPEDEQERPVALCEPGVNPEEQLIIIRSRLDQSMEENQDLKK
ELLKCKQEARNLQGIKDALQQRLTQQDTSVLQLKQELLRANMDKDELHNQNVDLQRKLDE
RNRLLGEYKKDLGQKDRLLQQQQAKLEDALRKLSDASYQQVDLERELEQKDVLLAHRVKG
DTDESSDLQLVRDALRSLRNSFSGHDPQHHTIDSLEQGISSLIERLHVIETQKKQERKVR
GRSPRNQASSEYRASWPPNSTLPHSQSSPAVSNTCTKVLYFTDRSLTPFMVNIPKRLGEV
TLKDFKAAIDREGSHRYHFKALDPEFGTVKEEVFHDDDAIPGWEGKIVAWERGLTPEDTE
KFLTRAAKKKLLQV
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgctgagctctgccacgttagatgaaacggtggagctgagagctggagaagagccgtct
gacgcttcactggggcaacagctacaggcctatgtggcctgggtgaatgcccagctgaag
aagaggccatccgtgaagcctgtgcaggacctgcgacaggatctccgagatggagtaatc
ctggcctatctcatcgagattgttgcaggagaaaaactgagcggagtacagttgagtcct
agtaaccagcaggagatgaagagcaatgtggagagggtcctacagtttgtggcttccaaa
aatattcgtatgcaccagacttcggctaaagatattgtggaaggaaacctgaagtctatc
atgaggctggtccttgccttggcagctcattttaaacctggctctagcaggacggtgagc
caggggcgagactccagaacctctgtgcagagtcatcaaccacactgtgccaccgctgtg
gcccaaggagcagcggctgctctggctgatgtgtgccatgacgtgtcacggtcaggacgg
gatgtcttcagatacagacagaggaatgccagtgtggatgaggagatcgagaacccatac
tggagtgtgcgagcacttgtgcagcaatacgaaggccagcaaaggtccccatctgagtcc
agctgctccagtctgacttcacccagtccaattcacagtgcaaagagcgaatccattata
acccagtcagaggaaaaggccgattttgtgattattccctctgaaggaatagagaacaga
acagacgagacaggctctccattatcccgagactggaggccgggaagcccaggaacctac
ctggaagccacatgggaagaacaactgttggagcaacaagaacacttggaaaaagaaatg
gaggaagccaagaaaatgatttcaggactacaggccttgctactcaatggctctctaccg
gaggatgaacaggaaagaccggtggccctctgtgaaccaggagtcaatcccgaggaacag
ctgattataatccgaagccgtctggatcaaagtatggaggagaatcaggaccttaagaaa
gaactgctgaaatgcaaacaagaagccagaaacttacaggggataaaggatgccttgcag
cagaggttgactcagcaggacacgtccgttcttcagctcaagcaagagctgctgagggca
aatatggataaggatgagctgcacaaccagaatgtggatctgcagaggaagcttgacgag
aggaaccggctcttaggagaatataaaaaagatctgggacagaaggaccgccttcttcaa
cagcagcaggccaagttggaagatgctcttcggaaactctcagacgccagttaccagcag
gtggatctagaacgggagctagagcaaaaagatgtccttctggctcaccgcgtgaaagga
gacacagatgagagcagtgacctccagctcgtccgagatgctctacgtagcctgcgaaac
agcttcagtggtcatgaccctcagcatcacaccattgacagcctggagcagggaatctct
agcctcatagagcgtctgcatgtcatagagacacagaagaaacaggaaaggaaggttcgg
gggcggtcacccagaaatcaagcaagcagtgaatatcgagcctcctggccccccaattcc
acgttgcctcactcccagagctccccggccgtcagcaacacctgcactaaagtgctctac
ttcacggaccgctcactcacgcccttcatggtcaatataccaaagaggctgggggaggtg
acactgaaggactttaaagcagctattgatcgagaagggagtcaccggtaccacttcaaa
gcactggatcccgagtttggcactgtcaaagaggaggttttccatgatgatgatgccatc
cctggatgggaagggaaaatcgtagcctgggaaagaggactaacaccagaggacactgag
aagtttctaactcgtgctgccaaaaagaagcttcttcaagtatga

DBGET integrated database retrieval system