KEGG   Rattus norvegicus (rat): 363067
Entry
363067            CDS       T01003                                 

Gene name
Sin3a
Definition
(RefSeq) paired amphipathic helix protein Sin3a
  KO
K11644  paired amphipathic helix protein Sin3a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04919  Thyroid hormone signaling pathway
rno05016  Huntington disease
rno05169  Epstein-Barr virus infection
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    363067 (Sin3a)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    363067 (Sin3a)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    363067 (Sin3a)
  09164 Neurodegenerative disease
   05016 Huntington disease
    363067 (Sin3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    363067 (Sin3a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     363067 (Sin3a)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    363067 (Sin3a)
SSDB
Motif
Pfam: Sin3a_C PAH Sin3_corepress
Other DBs
NCBI-GeneID: 363067
NCBI-ProteinID: NP_001102231
RGD: 1311598
Ensembl: ENSRNOG00000032254
UniProt: D3ZBP2
Position
8
AA seq 1129 aa
MKRRLDDQESPVYAAQQRRIPGSTEAFSHQHRVLAPAPPVYEAVSETMQSATGIQYSVAP
NYQVSAVPQSSGSHGPAIAAVHSSHHHPAAVQPHGGQVVQSHAHPAPSVAPVQGQQQFQR
LKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIM
GFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPTPAQ
PAPQPTPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQ
PVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYA
QVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRP
SQNGCQIRRHSGTGATPPVKKKPKLISLKESSMADASKHGVGTESLFFDKVRKALRSAEA
YENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLESFPKERAT
EGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVS
SKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGG
TSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWRE
QNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSL
AYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEE
EEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLH
QILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYY
PAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEVCVQ
VTDLYLAENNNGATGGQLSSQTSRSLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTI
ELLDTEEENSDDPVEAERWSDYVERYMSSDTTSPELREHLAQKPVFLPR
NT seq 3390 nt   +upstreamnt  +downstreamnt
atgaagcgacgtttggatgaccaggaatcaccagtgtatgcagcccagcagcgaaggatt
cctggaagcacagaggctttttctcaccagcaccgggttcttgccccggcccctcctgtg
tatgaagcagtgtctgagaccatgcagtcagctacaggcattcagtactcagtggcaccc
aactaccaggtttcagctgtgccacaaagttctggcagtcatgggcctgccatagcagcg
gttcatagcagtcatcatcacccagcagctgtccagcctcacggaggtcaggtggtccag
agccatgcccatccagccccgtcagttgcaccagtgcagggacagcagcaatttcagagg
ctgaaggtggaggacgccctgtcctaccttgaccaggtgaagctgcagttcgggagtcag
cctcaggtctacaatgatttcctcgacatcatgaaggaatttaaatctcagagcattgat
actccaggagtgattagccgcgtgtcccagctatttaaaggccaccctgacctgatcatg
ggcttcaatacctttttgcctcctggctataaaattgaggtgcagacaaatgacatggtg
aatgtgacaactcctggccaggttcatcagattcccacccatggcatccagccccagccc
cagccaccacctcagcatccttcccagccttcagcccagtcagctcccactcctgcccag
ccagctcctcagcccacacctgccaaagtcagcaagccttcccaactacaagcacatacg
ccagccagtcagcagactcccccactcccaccatatgcatccccacgttctccacccgtc
cagcctcacacaccagtgacaatctccttgggaacggctccatctttgcagaacaatcaa
cctgtggagtttaatcatgccatcaactatgttaataagatcaaaaacagattccagggc
caaccagacatctacaaagcattcctggagattttgcacacataccagaaagaacagcgg
aatgccaaggaagctggaggaaactatactccagctttgacggaacaagaggtgtatgcc
caggtggctcgtctcttcaaaaaccaggaagatctgttgtctgagtttggacagttcctg
ccagatgccaacagctcggtgcttttaagcaaaacaactgctgagaaggtggattctgtg
agaaatgaccatggaggcacagtgaagaagccccaactaaataacaagccacagaggccc
agtcagaacggctgccagatccgcaggcactctgggacaggagccacacctccggtgaag
aaaaaacccaaactgattagtctaaaggagtcttcgatggcagatgccagcaagcatggt
gttgggactgaatcgttattttttgataaggttcgaaaggctctccggagtgcagaggcc
tatgaaaacttccttcgatgccttgttatctttaaccaggaggtgatctctcgggcggag
cttgtacaactagtctctccttttctggggaaattccctgaattgtttaattggtttaaa
aactttttgggctataaggagtctgtgcatctggaaagctttccaaaggagcgcgccaca
gagggcattgctatggagatagactacgcctcttgtaaacggctgggctccagctaccgg
gcgctgccgaaaagttaccagcaacccaagtgtacagggcggactcctctgtgtaaggag
gttttaaatgatacctgggtttccttcccctcttggtctgaagactccactttcgttagt
tctaagaagactcagtatgaagaacatatttaccgttgtgaagatgaacgatttgagctt
gatgtggttctcgagaccaatcttgcaacaatccgggttttagaagcaatacagaaaaaa
ctttcccgcttgtctgctgaggaacaagccaaatttcgcttagataatactcttggaggc
acgtctgaagtcatccatcgaaaagcactccagaggatatatgctgacaaagcagcggat
atcattgatggcctgaggaagaatccctccattgctgttcccattgtccttaaaaggttg
aagatgaaggaggaagagtggcgggaagctcagagaggcttcaacaaggtctggcgagag
cagaatgagaagtactacttaaagtctttggatcaccagggcatcaacttcaaacagaat
gacactaaggtcttgaggtctaagagcttactcaatgagatcgagagcatctatgatgag
aggcaagagcaggctacagaagagaatgctggtgtacctgttggcccacacctctctctt
gcctatgaagacaagcagatattagaagatgctgctgctctgattatccatcatgtgaag
aggcaaacaggaattcagaaagaggacaaatacaaaatcaagcaaatcatgcatcatttc
attcctgatctgctgtttgctcagagaggggatctctcagatgtggaagaagaagaggag
gaagaaatggatgtggatgaagctacaggggcacctaagaagcacaatggtgttgggggc
agccccccaaagtccaagttgttatttagtaacacagcagctcagaagttaagagggatg
gatgaagtgtacaacctcttctatgtcaataacaattggtatatctttatgcggctgcat
caaattctctgcttaaggctgctacggatttgttcccaagctgagcggcaaattgaagaa
gaaaacagagagagagaatgggaacgggaggtgctaggcataaagagagataagagtgat
agtcctgccatacagctgcgtctcaaagaacctatggatgtggatgtagaagattattac
ccagctttcctggacatggtgcggagcctgcttgatggcaacatagactcatcacaatat
gaagattcactgagagagatgttcaccatccatgcctacattgcctttactatggacaaa
ttaatccagagcatcgtcagacagctgcagcatattgtcagcgacgaggtctgtgtgcag
gttactgacctttacttggcggaaaacaacaacggagccactggaggccagctgagcagt
cagacatcgaggagccttctggagtcgacataccagcggaaagcagagcagctcatgtcg
gatgagaattgctttaagctaatgttcattcaaagtcaaggtcaagttcagctgaccatt
gagctcctggacacagaagaggagaactcagatgaccctgtagaagcagagcgttggtca
gactatgtggaacgatatatgagttctgatactacttctccagaacttcgagaacatctg
gcacagaaaccagtatttctcccaaggtga

DBGET integrated database retrieval system