KEGG   Rattus norvegicus (rat): 363068
Entry
363068            CDS       T01003                                 

Gene name
Commd4
Definition
(RefSeq) COMM domain containing 4
  KO
K22560  COMM domain containing 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    363068 (Commd4)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    363068 (Commd4)
SSDB
Motif
Pfam: COMM_domain
Other DBs
NCBI-GeneID: 363068
NCBI-ProteinID: NP_001102232
RGD: 1306104
Ensembl: ENSRNOG00000018671
UniProt: D4A2Q7
Position
8q24
AA seq 177 aa
MRFRFCGDLDCPDWVLAEISTLAKIYEKILKLTADAKFESGDVKATVAVLSFILSSAAKH
SVDSDSLSSELQQLGLPKEHATSLCRCYEEKQSPLQEHLRACSLRVNRLASVGWRVDYTL
SSSLLHSVEEPMVHLQLQLVPAPGSLAQHVSMSLSADKFQVLLAELKQAQTLMTALG
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaggttccggttctgtggcgatctggactgtcccgattgggtcctagcagagatcagc
acactggccaaaatttatgagaagatcctgaagcttactgctgatgccaagttcgagtct
ggagatgtgaaggccacggttgcagtgctgagtttcatcctctccagcgccgccaagcat
agcgtggacagtgattccttgtccagtgagctgcagcagctggggctgcccaaagagcat
gccaccagcctgtgccgctgttatgaagagaagcagagccccctacaggagcaccttcgg
gcctgtagcctacgtgtgaacaggctggccagcgtgggctggcgggtagactacaccctg
agctccagcctgctacattctgtggaggagcccatggtacacctgcagctacagcttgtg
cctgctccaggttccctggcccaacacgtttccatgtccctctcagcagacaagttccaa
gttctcctggcagaactgaagcaagcccagaccctgatgactgctttgggctga

DBGET integrated database retrieval system