KEGG   Rattus norvegicus (rat): 363073
Entry
363073            CDS       T01003                                 

Gene name
Glce, RGD1565253
Definition
(RefSeq) glucuronic acid epimerase
  KO
K01793  heparosan-N-sulfate-glucuronate 5-epimerase [EC:5.1.3.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
rno01100  Metabolic pathways
Module
rno_M00059  Glycosaminoglycan biosynthesis, heparan sulfate backbone
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    363073 (Glce)
Enzymes [BR:rno01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.17  heparosan-N-sulfate-glucuronate 5-epimerase
     363073 (Glce)
SSDB
Motif
Pfam: C5-epim_C DUF4962
Other DBs
NCBI-GeneID: 363073
NCBI-ProteinID: XP_001073932
RGD: 1565253
Ensembl: ENSRNOG00000025372
UniProt: D3ZIK0
Position
8q24
AA seq 618 aa
MRCLAARVNYKTLIIICALFTLVTVLLWNKCSSDKAIQFPRHLSSGFRVDGLEKRSAASE
SNHYANHIAKQQSEEAFPQEQQKAPPVVGGFNSNGGSKVLGLKYEEIDCLINDEHTIRGR
REGNEVFLPFTWVEKYFDVYGKVVQYDGYDRFEFSHSYSKVYAQRSPYHPDGVFMSFEGY
NVEVRDRVKCISGVEGVPLSTQWGPQGYFYPIQIAQYGLSHYSKNLTEKPPHIEVYETAE
DRDRNIRPNEWTVPKGCFMASVADKSRSTNVKQFIAPEAGEGVSLQLGNTKDFIISFDLK
FLTNGSVSVVLETTDKNQLFTVHYVSNTQLIAFKDRDIYYGIGPRTSWSTVTRDLVTDLR
KGVGLSNTKAVKPTKIMPKKVVRLIAKGKGFLDNITISTTAHMAAFFAASDWLVRNQDEK
GGWPIMVTRKLGEGFKSLEPGWYSAMAQGQAISTLVRAYLLTKDYVFLNSALRATAPYKF
LSEQHGVKAVFMNKHDWYEEYPTTPSSFVLNGFMYSLIGLYDLKETAGEKLGKEARSLYE
RGMESLKAMLPLYDTGSGTIYDLRHFMLGIAPNLARWDYHTTHINQLQLLSTIDESPIFK
EFVKRWKSYLKGSRAKHN
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgcgttgtttggcagctcgggtcaactataagactttgattatcatctgtgcgttattc
actttggtcacagtacttttgtggaataagtgttccagcgacaaagcaatccagtttcct
cggcacttgagtagtggattcagagtggatggattagaaaaaagatcagcagcatctgaa
agtaaccactatgccaaccacatagccaagcagcagtcagaggaggcatttcctcaggaa
caacagaaggcaccccctgttgttgggggcttcaatagcaatgggggaagcaaggtgtta
gggctcaaatatgaagagattgactgtctcataaatgatgaacacacaattagagggaga
cgagaggggaatgaagtttttcttccattcacttgggtagagaaatactttgatgtttat
ggaaaagttgtccagtatgatggctatgatcgatttgaattctctcatagctattccaaa
gtctatgcacagagatcaccttaccaccctgacggtgtgtttatgtcctttgaaggatac
aatgtggaagtccgagacagagtcaagtgtataagtggagttgaaggtgtgccattatct
acacaatgggggcctcaaggctatttctacccaatccagattgcgcagtatgggctcagt
cattacagcaagaatctaaccgagaaaccccctcacatagaggtatacgagacagcagaa
gacagggacagaaacatcagacctaatgaatggactgtgcccaagggctgcttcatggcc
agtgtggctgataagtctagatccaccaatgttaaacagtttattgctccagaagccggt
gagggtgtgtctttgcagctgggaaatacaaaggacttcattatctcattcgacctcaag
ttcttaacaaacggaagtgtgtctgtggttctggagaccacagacaagaatcagctcttc
actgtgcactatgtctcaaatacccagctaattgcttttaaagacagggacatatactac
ggcattgggcccaggacttcatggagtacagttaccagggacctggtcactgacctcagg
aaaggagtgggcctttctaacacaaaagctgtcaagccaaccaaaatcatgcccaaaaaa
gtggttaggttgattgcaaaggggaaggggttcctggacaacattaccatctcaaccaca
gcccacatggctgcattctttgctgctagtgactggctagtgaggaaccaggatgagaaa
ggtggctggccaattatggtgacccggaagttaggggaagggtttaaatctttagagcca
ggatggtactctgccatggcacaagggcaagccatctctaccttagtcagggcctacctt
ctaacaaaagactatgtattcctcaattcagctttaagggcaacagccccatacaagttt
ctgtcagagcagcatggagttaaagccgtgttcatgaataaacatgactggtatgaagaa
tatccaactacacctagctcttttgttttaaatggctttatgtattctctgattgggctg
tatgacctaaaagaaacagcaggagagaagcttgggaaagaagcaaggtccttgtatgag
cgcggcatggaatctcttaaagccatgctgcccttgtatgatactggctccggaaccatc
tatgacctccgccacttcatgcttggcattgctcccaacctggcccgctgggactatcac
accacccacatcaaccagctgcagctgctcagcaccatcgacgagtccccaatcttcaaa
gaatttgtcaagaggtggaaaagctaccttaaaggcagtagggcaaagcacaactag

DBGET integrated database retrieval system