KEGG   Rattus norvegicus (rat): 363085
Entry
363085            CDS       T01003                                 

Gene name
Car12
Definition
(RefSeq) carbonic anhydrase 12
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00910  Nitrogen metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    363085 (Car12)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     363085 (Car12)
SSDB
Motif
Pfam: Carb_anhydrase YabP
Other DBs
NCBI-GeneID: 363085
NCBI-ProteinID: NP_001074225
RGD: 1306612
Ensembl: ENSRNOG00000017766
UniProt: A2IBE2
Position
8q24
AA seq 354 aa
MPHCSLHATVVLLLVILKEQPSSSAPLNGSKWTYIGPAGEKNWSKKYPSCGGLLQSPIDL
HSDILQYDASLAPLQFQGYNVSVEKLLNLTNDGHSVRLNLNSDMYIQGLQPHQYRAEQLH
LHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDLYSDFGSASDKSEGLAVLAVLIEIGSV
NPSYDKIFSHLQHVKYKGQQVLIPGFNIEELLPESPGEYYRYEGSLTTPPCYPTVLWTVF
RNPVQISQEQLLALETALYFTHMDDPSPREMVNNFRQVQKFDERLVYISFRQGLLTDTGL
SLGIILSVALAGVLGISIVLAVSVWLFKRKKSKKGDNKGVIYKPAIKKEAEVHA
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgcctcactgcagcctgcacgctactgtcgtcctcctattggtgatccttaaggagcaa
ccttccagctcagccccactcaacggatccaagtggacctacattggtcctgctggggaa
aagaactggtccaagaagtacccgtcatgtgggggtctcctgcagtccccgatagaccta
cacagtgacatccttcaatatgatgccagccttgcaccactccagttccaaggttacaat
gtgtctgttgaaaagctattgaacctaaccaatgatggccattcagtgagactgaatctg
aactcagacatgtacatccagggactccagcctcaccagtacagagcggagcagctgcac
ttgcactgggggaaccgcaatgacccccatggctctgaacacactgtgagtgggaagcac
tttgctgctgagctgcacatcgtccattataactcagacctgtactccgacttcggcagt
gccagtgacaagtcagaagggctcgctgtccttgctgttcttattgagataggctctgtc
aatccgtcctatgacaagatctttagtcatcttcaacacgtcaagtataaaggccaacaa
gtgctcatcccaggcttcaacattgaagaacttctgcctgagagccctggcgagtattac
cgctatgaagggtccctgactacacctccttgctaccctactgtgctctggacagttttc
cgaaaccctgtgcagatttcccaggagcagctgctagctttggagacagctctgtatttc
acacacatggatgatccttcccccagagaaatggtcaacaacttccggcaagtccagaag
tttgatgagaggctggtgtatatctccttccgacaaggactgcttaccgacacaggactg
agtttgggtatcatcctttcagtggccctggctggtgtccttgggatctccattgttctg
gcagtgtctgtttggctcttcaaaaggaagaagagcaaaaaaggtgacaacaagggagtc
atttataaaccagccatcaagaaggaggctgaggtccacgcctga

DBGET integrated database retrieval system