KEGG   Rattus norvegicus (rat): 363103
Entry
363103            CDS       T01003                                 

Gene name
Slc17a5
Definition
(RefSeq) sialin
  KO
K12301  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    363103 (Slc17a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    363103 (Slc17a5)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   363103 (Slc17a5)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    363103 (Slc17a5)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 363103
NCBI-ProteinID: NP_001009713
RGD: 1311388
Ensembl: ENSRNOG00000009330
UniProt: Q5Q0U0
Position
8
AA seq 495 aa
MRPLLRGPAGNDDEESSDSTPLLPSARQIEAAPACCSARYNLALLAFCGFFVLYALRVNL
SVALVDMVDSNSTLTDNRTSKECAEHSAPVKVHHNHTGKKYQWDAETQGWILGSFFYGYI
VTQIPGGYMASRIGGKLLLGLGILGTAVFTLFTPLAADLGVVALIVLRALEGLGEGVTFP
AMHAMWSSWAPPLERSKLLTISYAGAQLGTVISLPLSGIICYYMNWTYVFYLFGLVGIVW
FILWMWIVSDTPETHKTISHYEKEYIVSSLKNQLSSQKVVPWVSILKSLPLWAIVVAHFS
YNWTFYTLLTLLPTYMKEILRFNVQENGFLSALPYFGCWLCMIVCGQAADYLRVKWNFST
ISVRRIFSLIGMVGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFASSGFSINHLDIAPS
YAGILLGITNTFATIPGMIGPIIAKSLTPDNTIKEWQTVFCIAAAINVFGAIFFTLFAKG
EVQNWALSDHHGHGN
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgaggcccctgcttcggggtccggcgggaaacgatgatgaggaaagctcggacagcacc
ccgctcctgcctagcgcccggcagatcgaagcggctccagcatgctgctctgctcggtac
aatttagcactgttggcgttctgtggtttcttcgttctctatgctttacgggtgaacctg
agtgtggcgctagtggacatggtagattccaacagcactctgactgataacagaacttcc
aaggagtgtgcggaacactctgcccccgtaaaagtccaccacaaccacacaggtaaaaag
taccagtgggatgcagaaactcaagggtggattctcggctcctttttttacggctacatc
gtcacacagatccccggggggtacatggccagcagaatcggagggaagctgctgctgggc
ctgggcatcttaggcaccgccgtgttcaccctgttcacacccctggccgctgacctggga
gtggtggcgcttatcgtgctgagagcactggaaggactcggggagggtgtcacgtttccg
gctatgcatgccatgtggtcctcctgggctccccctctggaaagaagcaagcttctcacc
atttcttatgcaggagcacagcttgggacagtaatctcacttcctctttccggaataatt
tgctactatatgaattggacttatgtcttctacctttttggtttagttggaattgtctgg
tttattttatggatgtggatagtcagtgatacaccagaaactcacaagacaatctcccac
tatgaaaaggaatacattgtttcatcattaaaaaatcagctttcttcacagaaggtagtg
ccatgggtatccatcttgaagtcactgccactttgggcaattgtagtagcacatttttcc
tacaactggaccttttacactctactgacgttgttgcctacatatatgaaagaaatccta
aggttcaatgttcaagagaacgggtttttatctgcattgccctattttggctgttggtta
tgcatgattgtctgtggtcaagccgctgattatttaagagtcaagtggaatttttcaacc
ataagcgttcggagaattttttccctcataggaatggttggccctgcagttttcctagtc
gcggctggatttataggctgtgactattctttggctgttgcattcctaaccatatccacg
acgctgggaggcttcgcctcttctggatttagcatcaaccatctggatatcgccccttcg
tatgccggcatcctcctgggcatcacaaacacgtttgccaccattcccggaatgattggg
cccatcattgctaaaagtctgacccctgataacactattaaggaatggcagactgtcttc
tgtatcgctgctgctattaacgtgttcggcgccattttcttcacactgtttgccaaagga
gaggtgcagaactgggctctcagtgaccaccacggacacggaaactga

DBGET integrated database retrieval system