KEGG   Rattus norvegicus (rat): 363113
Entry
363113            CDS       T01003                                 

Gene name
Syncrip, Ab2-339, hnRNP_Q
Definition
(RefSeq) synaptotagmin binding, cytoplasmic RNA interacting protein
  KO
K13160  heterogeneous nuclear ribonucleoprotein Q
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    363113 (Syncrip)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    363113 (Syncrip)
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_7 RRM_occluded Calcipressin
Other DBs
NCBI-GeneID: 363113
NCBI-ProteinID: NP_001041381
RGD: 1305683
Ensembl: ENSRNOG00000000204
UniProt: Q7TP47
Position
8q31
AA seq 533 aa
MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAGQRKYGGPPPD
SVYSGQQPSVGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTF
CTKEAAQEAVKLYNNHEIRSGKHIGVCISVANNRLFVGSIPKSKTKEQILEEFSKVTEGL
TDVILYHQPDDKKKNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPD
PEVMAKVKVLFVRNLANTVTEEILEKSFSQFGKLERVKKLKDYAFIHFDERDGAVKAMEE
MNGKDLEGENIEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGG
RGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYEDFQVGARGRGGRGARGAAPSR
GRGAAPPRGRAGYSQRGGPGSARGVRGARGGAQQQRGRGVRGARGGRGGNVGGKRKADGY
NQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENEEFYQDTFGQQWK
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggctacagaacatgttaatggaaatggtactgaagagcccatggatactacttcagca
gttatccattcagaaaattttcagacattgcttgatgctggtttaccacagaaagttgct
gaaaaactagatgaaatttacgttgcaggtcagaggaagtatggggggccacctccagat
tctgtttattcaggtcagcagccttctgttggcactgagatatttgtggggaagatcccc
agagatctgtttgaagatgagcttgttccattgtttgagaaagctggacctatatgggat
cttcgtttaatgatggatccacttactggtctcaacagaggttatgcctttgtcactttt
tgtacaaaagaagcagcacaagaggctgttaaactgtataataatcatgaaattcgttcc
gggaaacatattggtgtctgcatctcagttgccaacaataggctttttgtgggctctatt
cctaagagtaaaaccaaggaacagattcttgaagaatttagtaaagtgacagagggtctc
acagatgtcattttataccaccaacctgatgacaagaaaaaaaacagaggcttttgcttt
cttgaatatgaagatcataaaacagctgcccaggcaaggcgtaggctaatgagtggtaaa
gttaaagtctggggaaatgttggaactgttgaatgggctgatcctattgaagatcctgat
cctgaagttatggcaaaggtaaaagtgctgtttgtacgcaaccttgccaacactgtaaca
gaagaaattttagaaaagtcgtttagtcagtttgggaaactggaacgagtgaagaagcta
aaagattatgctttcattcattttgatgagagagatggtgctgtcaaggctatggaagaa
atgaatggtaaagacttggagggagaaaacattgaaattgtttttgctaagccaccagat
cagaagaggaaagaaagaaaagctcagaggcaagcagcaaagaatcaaatgtatgatgat
tactactattatggtccacctcatatgccccctccaacaagaggtcgagggcgtggaggt
agaggtggctatggatatcctccagattattatggatacgaagattattatgattattat
ggttatgattaccataactatcgtggtggatatgaagatccatattatggttatgaagat
tttcaagttggagctagaggaaggggtggtagaggagcaaggggtgctgctccatccaga
ggtcgcggggctgctcctccccgtggtagagccggttattcacagagaggaggccctgga
tcagcaagaggcgttcgtggtgcgagaggaggtgcccaacaacaaagaggccgcggggta
cgtggtgcaaggggtggccgcggtggaaatgtaggaggaaagcgcaaagctgatgggtac
aaccagccagattccaagcggcgccagaccaataatcagaactggggctcccaacccatt
gctcagcaaccgctccaaggtggtgatcattctggtaactatggttacaaatctgaaaac
gaggagttttatcaggatacttttgggcaacagtggaagtag

DBGET integrated database retrieval system