KEGG   Rattus norvegicus (rat): 363115
Entry
363115            CDS       T01003                                 

Gene name
Slc9a9, RGD1560736
Definition
(RefSeq) solute carrier family 9 member A9
  KO
K14725  solute carrier family 9 (sodium/hydrogen exchanger), member 9
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    363115 (Slc9a9)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   363115 (Slc9a9)
SSDB
Motif
Pfam: Na_H_Exchanger
Other DBs
NCBI-GeneID: 363115
NCBI-ProteinID: NP_001258367
RGD: 1560736
Ensembl: ENSRNOG00000008554
UniProt: D4A7H1
Position
8q31
AA seq 644 aa
MAGQLRLTSGKDEDHFQHQGAVELLAFNFLLILTILTIWLFKNHRFRFLHETGGAMVYGL
IMGLILRYATAPTDIDSGTVYNCGKLLFSPSTLLVNITDQVYEYKYQREINQHNISPHQG
NAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSILTYAFLGTAISCVVIGLI
MYGFVKAMVHAGQLKSGDFHFTDCLFFGSLMSATDPVTVLAIFHELHVDPDLYTLLFGES
VLNDAVAIVLTYSISIYSPKENPNAFDTAAFFQSVGNFLGIFAGSFAMGSAYAVVTALLT
KFTKLREFPMLETGLFFLLSWSAFLSAEAAGLTGIVAVLFCGVTQAHYTYNNLSSDSKLR
TKQLFEFMNFLAENVIFCYMGLALFTFQNHIFNALFILGAFLAIFVARACNIYPLSFLLN
LGRKQKIPWNFQHMMMFSGLRGAIAFALAIRNTESQPKQMMFTTTLLLVFFTVWVFGGGT
TPMLTWLQIRVGVDLDESLKEEPSSQQEANKVDKDMTKTESAQLFRMWYGFDHKYLKPIL
THSGPPLTTTLPAWCGPVSRLLTSPQAYGEQLKEDDVECIVNQDELAMNYQEQSPTSSSP
ATKLALDQKSSGLTLGKENIYEGDLGLGGYELKLEQTRGQPQMD
NT seq 1935 nt   +upstreamnt  +downstreamnt
atggcggggcagcttcggcttacgtcagggaaggatgaagatcattttcaacaccaggga
gcagtggagctactcgcgtttaattttttgctcatccttaccattttaacaatctggtta
tttaaaaatcatcgattccgcttcttgcatgagactggaggggcgatggtgtatggcctc
ataatgggattaattttgcgatatgccacagcgccaactgatatcgatagtggcactgtc
tacaattgtggaaagttactcttcagcccatcaactctactagtcaacatcactgaccaa
gtttatgaatacaagtaccagagagaaatcaaccagcacaacatcagcccccaccaaggc
aatgctatactggagaagatgacgtttgacccggaaatcttcttcaatgtcttactacct
cccattatatttcatgcaggatacagtctgaagaagaggcacttttttcaaaacttggga
tccattttaacgtatgccttcttgggaacagccatctcctgtgtggtcatagggttaatt
atgtatggctttgtgaaggccatggtgcacgctggccagctgaagagcggagacttccac
ttcactgactgtttgttttttggttcactgatgtctgctacagatccagtgacagtgctg
gccattttccatgagctacacgtggaccctgacctgtacacactgctgtttggggagagc
gtgctgaatgatgcggtggccatagtcctcacatactctatatccatctatagtcccaag
gagaatcccaacgcgtttgacacggcagcgttcttccaatctgtgggcaatttcctgggg
atctttgccggctcctttgcgatgggctctgcatacgcagttgtcacagcactgttgacc
aaatttaccaagctccgtgagttcccaatgctggagacaggcctgtttttcctgctttct
tggagtgccttcctgtctgccgaggccgccggcttaacaggcatagttgcggttctcttc
tgtggagtcactcaagcacattacacctacaacaatctgtcatcggattccaaactgagg
accaaacagctgtttgaatttatgaacttcctggctgagaacgtcatcttctgctacatg
ggcctggctctgttcacctttcagaatcacattttcaatgctctttttatactcggagcc
tttctagcaatttttgtcgccagggcctgcaacatttaccccctctccttcctcctgaat
ctgggcagaaagcagaagattccctggaacttccagcacatgatgatgttttcaggtttg
cgaggtgcaattgccttcgccctggccatccgcaacacggaatctcagcctaaacagatg
atgttcaccaccacactgctcctcgtgttcttcactgtctgggtgttcggaggaggaacg
acccccatgctgacatggcttcagatcagagtcggtgtggacctggatgaaagtttgaag
gaagagccctcctcacagcaggaagcaaataaggtggataaagacatgacgaagacagag
agtgcacagctcttcaggatgtggtacggatttgaccacaaatacctgaaacccatctta
acacattccggccctccactgaccaccacgttgccggcatggtgtggcccagtctccagg
ctgctcaccagtcctcaggcctatggggaacaactgaaagaggatgatgtggaatgtatc
gtcaaccaagatgaactcgccatgaattaccaggagcagagccccacttccagcagtcct
gccacaaagctagctctggaccagaagtcttcaggcctgactttagggaaggaaaacatc
tacgagggagacctcggcctcggaggctatgaactcaaactggagcagactcggggtcaa
ccccagatggactaa

DBGET integrated database retrieval system