KEGG   Rattus norvegicus (rat): 363131
Entry
363131            CDS       T01003                                 

Gene name
Pik3r4
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 4
  KO
K08333  phosphoinositide-3-kinase, regulatory subunit 4 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04136  Autophagy - other
rno04140  Autophagy - animal
rno04371  Apelin signaling pathway
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    363131 (Pik3r4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    363131 (Pik3r4)
   04136 Autophagy - other
    363131 (Pik3r4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    363131 (Pik3r4)
   05014 Amyotrophic lateral sclerosis
    363131 (Pik3r4)
   05016 Huntington disease
    363131 (Pik3r4)
   05017 Spinocerebellar ataxia
    363131 (Pik3r4)
   05022 Pathways of neurodegeneration - multiple diseases
    363131 (Pik3r4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    363131 (Pik3r4)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    363131 (Pik3r4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     363131 (Pik3r4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  VPS15 family
   363131 (Pik3r4)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    363131 (Pik3r4)
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    363131 (Pik3r4)
SSDB
Motif
Pfam: Pkinase WD40 PK_Tyr_Ser-Thr IFRD HEAT_2 TCAD9
Other DBs
NCBI-GeneID: 363131
NCBI-ProteinID: NP_001102247
RGD: 1311809
Ensembl: ENSRNOG00000013669
Position
8
AA seq 1331 aa
MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDP
TLPLTSYKQELEELKIRLHSAQNCLPFQKAAEKASEKAAMLFRQYVRDNLYDRISTRPFL
NNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNP
ADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRTRGELKRAMD
IFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKIEDRSIRELVTQMIQREPGQ
RLEADDYLKQQRGNAFPEVFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGH
DLPEKAEGESKASGLVVLVSVITSCLQTLKSCDSKLAALELILHLAPRLSVEILLDRITP
YLLHFSNNSVPRVRAEALRTLTKVLALVQEVPRNDVNIYPEYILPGIAHLAQDDATIVRL
AYAENIALLAETALRFLELVQLKTLNMENEPDSEEVDEATRPNGDYDTELQALHEMVQQK
VVTLLSDPENIVKQTLMENGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDS
IVGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKALNALTCMCQLGLLQKPHVYEFASDI
APFLCHPNLWIRYGAVGFITVVAHQISTADVYCKLMPYLDPYITQPVIQIERKLVLLSVL
KEPVSRSIFDYALRSKDIASLFRHLHMRQKKRNGSLLDCPPPEDPAIAQLLKKLLSQGMT
EEEEDKLLALKDFMMKSNRAKANAVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEP
DEKRARKHVKQDSNVNEEWKSMFGSLEPPNIPQALPKTSDHEVVPTGKSPRSESSAGVCV
PLSTSPQVSEAAHIPSKKPVIPVVSSTVLPSTYQIRITTCKTELQQLIQQKREQCNAERI
AKQMMENAEWESKPPPPGWRPKGLLVAHLHEHKSAVNRIRVSDEHLLFATCSNDGTVKIW
NSQKMEGKTTTTRSILTYSRIGGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSP
KIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLK
SGLITSFAVDIHQCWLCIGTSSGAMACWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWV
IAAVQGNNEPSPHSVHGIYCSPADGNPILLTAGSDMKIRFWDLVSPERSYVVAGSTGSPS
VSYYKKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDIATFQTTQGFIVT
ASRDGIVKVWK
NT seq 3996 nt   +upstreamnt  +downstreamnt
atgggaaaccaactagctggtattgctccttcccagatcctgtccgtagagagctacttc
tcagacatccatgactttgaatatgataagagtctgggaagtactcggttttttaaagtt
gctcgagcgaagcaccgggagggcctggtggttgtgaaggtctttgcaatccaggatccc
acgttgcctttaactagttataaacaggagctggaggaactgaaaatcaggctccattcg
gcccagaactgcttacctttccagaaagcagcagaaaaagcatcggagaaagcggccatg
ctgttcaggcagtacgtgagggacaacctctacgaccgtatcagtacccgtcccttctta
aataacatcgagaagcgctggatcgccttccagatcctgacagctgtggaccaagcacac
aagtctggagtccgccacggtgacatcaagacagagaacgtgatggtcaccagttggaac
tgggttctcctcactgattttgccagttttaagcccacttatcttccagaggacaaccca
gcagatttcaactatttctttgacacctcgaggaggaggacttgctacatcgcccctgag
cgtttcgtggatggcggtatgttcgccaccgagttagaatacatgagagatccctcaact
cctcttgtcgacctaaatagcaatcagagaacacggggagagttgaagagggccatggac
atcttttcagcaggttgcgtgatagccgagctcttcacggaaggcgtgccgttgttcgat
ctctcacaactgttggcatacagaaatggacattttttccctgagcaagtgctaaataaa
atcgaagatcgcagtatcagagaattggtaactcagatgatccagcgggagccgggacag
cgtttggaagctgacgactacctgaagcagcagcgtggcaatgctttccccgaggtattc
tatactttccttcagccgtacatggctcagttcgccaaggagacctttctctctgcagat
gagcggattttggttatacggaaagacttgggcaatatcattcacaacctctgtggacat
gacttgccagagaaagcagaaggggagtccaaggctagcgggctggttgtcctggtgtca
gtgataacgtcctgcctgcagacactgaagtcctgcgactccaaactggctgccttggag
ctcattctgcatttggccccgaggctgagcgtagagatccttctggatcgcatcaccccc
tacttgttgcatttcagcaacaactctgttcctcgagtgcgggctgaagccctgaggaca
ctcaccaaagtccttgcccttgtccaagaagttcctcgcaatgatgtcaatatctaccca
gagtacattctccccggcatagctcacctggcccaggacgacgccaccatcgtcagactg
gcctacgctgaaaacatagctctgttggccgagacggctctgcgattcctggaactagtg
cagctaaaaactctcaacatggagaacgagccggacagtgaagaggtagatgaagccacg
cgtcctaacggagactatgacacagagctccaggccctacacgaaatggtccagcagaag
gttgtcactttgttaagtgaccctgagaatattgtgaaacagacattgatggagaatggg
atcacacgcttgtgcgtcttctttggacggcagaaagccaacgacgttctcttgtcccac
atgatcacgttcctgaatgataagaatgactggcacctgcgtggagctttcttcgatagc
atagtcggtgtggctgcctatgttggctggcagagctcctccatcctcaagcccctgctc
cagcaaggcctcagcgatgccgaggagttcgtcattgtgaaagctctcaatgccctgacc
tgtatgtgccagttagggctgctgcagaaacctcatgtctatgaattcgccagtgatatt
gctcccttcctgtgtcaccctaatctgtggatacgctatggtgccgtgggattcatcacc
gtggtagctcatcagatcagcactgctgacgtctactgcaagctcatgccgtatcttgac
ccgtatattacacaaccagtaatacagattgaaaggaagcttgtcttgcttagcgttcta
aaagagccggtgagtcgctctatatttgattatgctctgaggtccaaagacatcgctagc
ttgttcagacatcttcacatgcgtcagaagaagcggaatggctctcttcttgactgccct
ccgcccgaggaccctgccatagcacagcttctgaagaaactgctctcccaggggatgacc
gaagaagaggaagataaacttctggctctgaaggacttcatgatgaaatcaaatcgagca
aaagctaatgcagtagaccagagccacctgcatgacagcagccagaaaggtgtaattgac
ttggcagccttgggcatcactgggagacaagttgaccttgttaaaaccaagcaagagccc
gatgagaaacgggctaggaagcatgtgaaacaagactccaatgtaaatgaagaatggaaa
agcatgtttgggtcactggaaccaccgaatatcccacaggccctgcctaaaaccagtgac
catgaggtggttccaacggggaagtcacctcgctctgagtcctctgctggtgtctgtgtc
cctttgtcaacctctccacaggtttccgaagcagcacacatccccagtaagaagccggtg
attccggttgtaagtagcacggtcctgccatccacttaccagatccggatcaccacttgc
aagactgaacttcagcagctcatacaacagaagcgtgagcagtgtaacgcagagcgcata
gccaagcagatgatggagaacgccgagtgggagagcaagccacctccacctgggtggcgt
cctaaagggctcctagttgcacatcttcatgagcacaaatctgctgtaaatcgaatcaga
gtctccgatgaacacttactctttgcaacgtgctcaaatgatggtacagtgaaaatctgg
aacagtcagaagatggaggggaagaccactacgacgaggtctattctgacatacagccga
attggagggcgagtcaagacactaacattttgccaaggctcccactacttggccatagca
tctgataatggtgctgtccagcttcttggaattgaggcttctaagttacccaagtctcct
aaaatccaccctctacaaagcaggattctggatcagaaggaagacggatgtgtggtggac
atgcatcacttcaactcgggggcacagtctgttcttgcctatgccacagtgaatggctct
ctggttggatgggatctcaggtcatcaagcaacgcatggacattaaagcatgacctgaag
tcaggcctcatcacctcctttgctgtggacatccaccagtgctggctgtgcataggcacg
agcagcggggccatggcgtgttgggacatgaggttccagttgccaatttccagtcactgt
catccctccagagctcgtatccggcgcctctccatgcaccccttgtaccagtcctgggta
attgcagctgttcagggcaacaatgaaccctcaccgcacagcgtccatggcatctactgc
agccctgcggatggcaaccctatcctgctgaccgctggctcagacatgaaaataaggttc
tgggacttggtttccccagagaggtcctatgttgtagcgggaagcacgggttccccgtct
gtatcctactacaagaagataatagaaggcacggaggttgtccaggaaattcagaataag
cagaaggttggaccaagtgatgacacccctcgaaggggcccggagtctctgcctgtggga
catcatgacatcatcacagatattgccaccttccagaccactcagggcttcattgtgact
gcttctagagatgggattgtgaaggtgtggaaataa

DBGET integrated database retrieval system