KEGG   Rattus norvegicus (rat): 363150
Entry
363150            CDS       T01003                                 

Gene name
Elp6, RGD1305478, Tmem103
Definition
(RefSeq) elongator acetyltransferase complex subunit 6
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: ELP6
Other DBs
NCBI-GeneID: 363150
NCBI-ProteinID: NP_001102252
RGD: 1305478
Ensembl: ENSRNOG00000020847
UniProt: B2RYG8
Position
8q32
AA seq 266 aa
MFPELNNLLSITPDRTEQGKLTLLCDAKTDGSFLVHHFLSFYLKANCKVCFVALVQSFSH
YNIVGQKLGVSLTAARERGQLVFLEGLKSSVEVLFHSQEEPHPLQFLREAGAGNLQSLYT
FIQDTLKPADSGESPWKCPVLLVDNLSVLLSLGVGAVAVLDFMQYCRATVCCELKGNVVA
LVHDTEGAEDEENNILLNGLSHQSHLILRTQGLATGFCKDVHGQLSILWRRSSQPTAQRA
RSLTYQYKIQDKNVSFFAKGMSRAVL
NT seq 801 nt   +upstreamnt  +downstreamnt
atgttcccggaactcaacaaccttctcagcatcaccccagacaggaccgagcaggggaaa
ctgactctcctctgtgacgccaagacagacggcagcttccttgtgcatcacttcctgtcc
ttctacctgaaagctaattgtaaagtctgcttcgtggcacttgtccagtctttcagccat
tacaatattgtgggacagaaactgggcgtcagcttgaccgcagcgcgggagcgagggcag
cttgtgttcctggagggcctcaagtcctccgtggaagtcctcttccactctcaggaggag
cctcaccccctgcagtttctcagggaggctggtgcagggaacctacagtcgctgtatacg
tttatacaggacaccctgaagcccgcggacagtggggagtcgccatggaagtgcccagtc
ctgttggtggacaacctcagtgtgctgctgagcctgggtgtgggggcagttgccgtgctg
gatttcatgcagtactgcagggccacggtgtgctgcgaactgaagggaaatgtggtagcc
ctcgtgcacgacactgaaggtgctgaggatgaagagaataacatcctactgaatggcctc
agtcatcaaagtcacctgatcctgcggactcagggcctggccaccggattctgcaaggac
gtgcatgggcagctgagcattctctggaggaggtcgtcgcagcccacagcccagcgggct
cgaagtctcacttaccaatacaagatacaggataagaatgtgtccttttttgccaaagga
atgtctcgtgctgttctgtga

DBGET integrated database retrieval system