KEGG   Rattus norvegicus (rat): 363165
Entry
363165            CDS       T01003                                 

Gene name
Csrnp1, Axud1
Definition
(RefSeq) cysteine and serine rich nuclear protein 1
  KO
K17494  cysteine/serine-rich nuclear protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    363165 (Csrnp1)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    363165 (Csrnp1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     363165 (Csrnp1)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     363165 (Csrnp1)
SSDB
Motif
Pfam: CSRNP_N
Other DBs
NCBI-GeneID: 363165
NCBI-ProteinID: NP_001102256
RGD: 1305999
Ensembl: ENSRNOG00000033433
UniProt: D4AAK3
Position
8q32
AA seq 581 aa
MAGIQKRKFDQLEEDDCSSSSLSSGDLSPSPPSSSASPAWTSEEEGLGDQPPQPDQDSSG
IQSLMPPSILKRAPRERPGHVAFDGITVYYFPRCQGFTSVPSHGGCTLGMASRHSTCRLF
SLAEFKQEQFRARREKLRRRLKEEKLEMLKWKLSVSGVPEAGADVPLTVDAIDDASVEED
LAVAVAGGRLEEANFLQPYPPRQRRALLRASGVRRIDREEKRELQALRQSREDCGCHCDG
VCDPETCSCILAGIKCQMDHTSFPCGCCSEGCENPHGRVEFNQARVQTHFIHTLTRLQME
QGAESLGDPESPMEDVPVEQTVVSPFPPSKPTMSNDLGDSSCGSDMTDSSTTYSSGGSGS
RSEAPNHLAHPSLPGSSFRSGIDEDSLEQILNFSDSDLGIEEEEEEGGSVGNLDNLSCFH
LADIFGTGDPGSLASWTHSQFGSSLPSGILDENANLDASCFLSSGLEGLREGSLPSSSGS
PEGEAAQSSSLDLSLSSCDSFELLQSLPDYSLGPHYTSRRVSGSLDSLETFHPSPSFSPP
RDASFLDSLIGLSEPVTDVLAPLLESQFEDTAVVPLDPVPV
NT seq 1746 nt   +upstreamnt  +downstreamnt
atggctgggatacagaagaggaagtttgaccagctggaagaggacgactgcagctcctcc
tccttgtcctctggcgatctctctccctctcctcccagctcttctgcctcccctgcctgg
acctctgaggaggagggactgggtgatcagccaccccagcctgatcaggactccagtggc
atccagagtttaatgcccccatccatcctgaagcgggctcctcgggagcgtccgggtcac
gtggccttcgatggcatcactgtctactatttcccgcggtgccagggattcaccagtgtg
cccagccatggtggctgtaccctgggcatggcttctcgtcatagcacctgccgcctcttc
tccttagccgagtttaaacaggagcagttccgggctcggcgtgagaagctccgtcggcgt
ttaaaggaggagaagctagagatgctgaaatggaagctttcagtgtccggagttccggag
gcaggggcagacgtgccgctcacagtggacgccatcgatgacgcttctgtagaggaggac
ttggcagtggccgtggcaggtggccgcctggaggaagcgaatttcctacagccctatcca
cctcggcagcgacgggccctacttcgcgcttccggtgttcgaaggattgaccgagaggag
aagcgcgagctgcaggcgctacgccaatcccgggaggattgtggttgtcactgtgatggc
gtctgtgaccctgagacctgcagttgcatcctggccggcattaaatgccagatggatcac
acgtccttcccctgtggctgctgcagcgagggctgtgagaacccccatggtcgagtggaa
ttcaatcaggcgagagttcagacacacttcatccacacgctcacccgcctgcagatggag
cagggtgcggagagtttgggggacccggagtcccccatggaggacgttcctgtcgaacaa
accgtggtttccccctttcctccttccaaacccactatgagcaatgacctgggggacagc
agctgtggcagcgacatgacagactcttccacgacctactcctctggcggcagtggcagc
cgcagcgaggctccgaaccatcttgcccaccccagcctgccaggttccagcttccggtct
ggcatagatgaagacagcctggaacagatcctgaatttcagtgactctgacctcggtatt
gaggaagaagaggaggagggagggagtgtgggcaacttggataacctcagctgttttcat
ttggctgacatctttggtaccggtgaccccggcagcctggctagctggacacacagccag
tttggctctagccttccatcgggcatcctagatgagaatgccaacctggacgccagctgc
ttcctaagcagcggactcgaagggttgagagaaggtagcctccccagcagttctgggtcc
cctgagggggaagccgcccagagcagctccttggacctcagtttatcctcctgtgactcc
tttgagcttctccaatctctgccagattatagtctggggcctcactatacttcccgaagg
gtatctggcagcctggacagccttgagaccttccacccttcgcccagcttctctccaccg
agggatgccagcttcctggattctctcataggcctgtctgagccggttacagatgtcctg
gcgccccttctggagagccagtttgaggacactgctgtggtgcctttggaccctgtgcct
gtgtaa

DBGET integrated database retrieval system