KEGG   Rattus norvegicus (rat): 363194Help
Entry
363194            CDS       T01003                                 

Gene name
Xpo5, Exp5, RanBp21
Definition
(RefSeq) exportin 5
  KO
K14289  exportin-5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    363194 (Xpo5)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    363194 (Xpo5)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     363194 (Xpo5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N
Motif
Other DBs
NCBI-GeneID: 363194
NCBI-ProteinID: NP_001102259
RGD: 1311522
Ensembl: ENSRNOG00000019085
UniProt: D3ZQE8
Position
9q12
AA seq 1204 aa AA seqDB search
MEMEQVNALCEELVKAVTVMMDPSSTQRYRLEALKFCEEFKEKCPICVPCGLKLAEKTQI
AIVRHFGLQILEHVVKFRWNSMSRLEKVYLKNSVMELIANGTLSILEEENHIKDVLSRIV
VEMIKREWPQHWPDMLMELDTLSRQGETQRELVMFILLRLAEDVVTFQTLPTQRRRDIQQ
TLTQNMERILNFLLSTLQENVNKYQQMKTDASQEAEAQANCRVSIAALNTLAGYIDWVSL
NHITAENCKLVETLCLLLNEQELQLGAAECLLIAVSRKGKLEDRKRLMILFGDVAMHYVL
SAAQTADGGGLVEKHYLFLKRLCQVLCALGNLLCALLALDANIQTPVNFGMYLESFLAFT
THPSQFLRSSTHMTWGALFRHEVLSRDPSLLAVIPKYLRASMTNLVKMGFPSKTDSPSCE
YSRFDFDSDEDFNAFFNSSRAQHGEVVRCVCRLDPKTSFQMAAEWLKYQLSAAIDTGPVN
SCSTAGTGEGGFCSIFSPSYVQWEAMTFFLESVINQMFRTLEKEELPVNEGIELLQLVLN
FEMKDPLILSCVLTNVSALFPFVTYKPAFLPQVFSKLFSFVTFESVGESKAPRTRAVRNV
RRHACSSINKMCRDYPDLVLPNFDMLYSHVKQLLSNELLLTQMEKCALMEALVLVSNQFK
DYERQKLFLEELMAPVVNIWLSEEMCRALSDIDAFIAYVGADLKSCDPAAQDPCGLNRAR
MSFCVYSILGVMRRTTWPSDLEEAKAGGFVVGYTPSGNPVFRNPCTEQILRLLDNLLALV
RTHNTLYTPEMLTKMAEPFTKALDIVESEKTAILGLPQPLLEINDHPVYRTILERMQRFF
GILYENCYHILGKAGPSMQQDFYTVEDLATQLLGSAFVNLNNIPDFRLRSMLRVFVKPLV
LFCPPEHYETLISPILGPLFTYLHMRLSQKWHVINQRSVLCGEDEIAEDNPESQEMLEEQ
LVRMLTREVMDLIMACCVSKKTAEHTATPTADGDDEEMMATEVAPSSVVELTDLGKCLMK
HEDVCTALLITAFNSLTWKDTLSCQRATTQLCWPLLKQVMSGTLLADAVTWLFTSVLKGL
QMHGQHDGCMASLVHLAFQIYEALRPRYLEIRAVMEQIPEINKESLDQFDCKLLNPSLQK
AADKRRKDHFKRLIAGCIGKPLGEQFRKEVHIKNLPWLFKKSKPMLETEVLDSEEGGLAT
IFEP
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atggagatggagcaagtgaacgcgctgtgcgaggagctagtgaaagcggtgacggtcatg
atggaccccagctctacccagcgctaccggctggaagccctcaagttttgtgaagagttt
aaagaaaagtgccctatctgtgtcccatgtggcttgaagttggccgaaaaaacacaaatt
gccatcgtcagacattttggccttcagatcctggaacacgttgtcaagtttcggtggaac
agcatgtctcgattggagaaggtctacctgaagaacagtgtcatggagctgattgcaaat
ggaacactgagcattttggaggaggagaaccatattaaagatgttctgtctagaattgtg
gtggagatgatcaagcgagagtggcctcagcactggcctgacatgctcatggagttggac
actctctccaggcaaggggaaacacagagggaattggtgatgttcatccttttgcgactg
gctgaggatgtagtgacctttcagacactgcccactcaaagaagaagggatattcagcaa
acgttaacacagaacatggaaagaatcttgaattttctactcagtacacttcaggaaaat
gtaaacaagtaccagcaaatgaagacagatgcctctcaggaagcagaggctcaagccaac
tgtcgagtgagcatcgcggcactgaacacgctagcaggctacattgactgggtgtctttg
aatcacattactgctgagaactgtaagctggtggaaactctgtgcctgcttctcaatgag
caggagctgcagttgggagccgctgagtgtcttctcattgcagtcagcagaaaaggcaag
ctggaggaccggaagcgcttgatgatcttgtttggggacgtggccatgcactatgttctc
tccgccgcacagactgctgatggaggaggcttggtggaaaaacactacctcttcctgaag
agactttgtcaggtgttgtgtgctctgggaaatctgctgtgtgcactgctggccttagat
gctaacatacaaacaccggtaaactttggaatgtacctggagtcttttcttgctttcaca
acccacccaagtcagtttctacgctcttcaacccatatgacgtggggagccctcttcagg
catgaagttctgtcccgggatccgtcgctgttagcggtgataccaaaatatcttcgtgct
tctatgacgaacttggtcaagatgggttttccttccaaaacagacagccccagctgtgaa
tattcccggtttgactttgacagtgatgaggacttcaatgctttcttcaactcctcccga
gcccagcatggagaggtggtgaggtgcgtgtgtcgactggatcctaagactagcttccag
atggcggcagagtggctcaagtatcagctgtcagctgctattgacactggacctgtgaac
tcatgttctacagctggaactggagagggaggcttctgctccatcttctcaccttcatac
gtgcagtgggaagccatgactttttttttggaaagtgtgatcaaccagatgtttcgaaca
ctagagaaagaagagctcccggtaaatgaggggatagagctgctgcagctggttttgaac
tttgagatgaaggatcccctcatcctgtcctgtgtcctcaccaatgtctcagcactcttt
ccatttgtcacatacaagcctgccttcttgccccaggtcttctcgaagctcttttcattt
gtcacttttgaatctgttggggaaagtaaggcccccaggactcgggcagtcaggaatgta
aggagacatgcgtgttcctccatcaacaagatgtgtcgagactacccagaccttgttctg
cccaattttgacatgctttatagccatgtgaagcaactcctctccaatgagctcctcctg
acccagatggagaagtgtgctctcatggaagccctggttctcgttagcaaccagtttaag
gattatgagcggcagaagttattcctagaggagctgatggcaccggtggtcaacatctgg
ctctctgaagaaatgtgcagagcactgtcagatattgacgccttcattgcctatgtgggt
gctgatctgaagagctgtgacccggctgcgcaggacccgtgtggcttgaaccgtgcacga
atgagcttttgtgtgtacagcatcctgggggttatgagacgaactacctggccttccgac
ctagaagaagccaaagctggggggttcgtggtgggttatacacccagtgggaatccagtc
ttccgtaacccctgcacagagcagatcctcagacttctcgacaatttgcttgccctcgta
agaactcacaatactttatatacaccggagatgctaaccaaaatggcagagcctttcacc
aaggctctggatattgttgaatctgaaaaaacggcaatattaggattacctcagcctctc
ttggaaatcaatgaccaccctgtctatagaaccattttggaaagaatgcagcggttcttc
ggcatcctctatgaaaactgttaccacatcctagggaaggcaggcccttccatgcaacaa
gatttctacactgtggaggaccttgctacccagctccttggttcagctttcgtcaacttg
aacaatattcctgacttccggctcagatctatgcttcgtgtcttcgtgaagcccctcgtg
ctcttctgccccccagaacactatgagaccctgatatctcccatccttggaccgctcttc
acctaccttcacatgaggctttctcagaagtggcatgtcatcaaccagaggagtgtcctg
tgtggagaagatgagattgcagaggacaaccccgaatctcaagaaatgctggaggaacag
ctggtgaggatgttaacccgagaagtcatggacctaatcatggcttgttgtgtgtcaaag
aagactgccgagcacactgccactcccactgcggatggagacgacgaggagatgatggcc
accgaagtagccccttcgtctgttgtggagctcacagacctgggcaaatgcctgatgaag
catgaggatgtttgcacggcactgttgatcacagcatttaattccctgacctggaaggat
accctgtcttgccagagggcgaccacacagctctgttggcctctcctcaaacaggtgatg
tctgggaccctgctcgcagatgccgtcacgtggctcttcaccagtgtgctgaaagggctg
cagatgcatgggcaacacgacgggtgcatggcttccctggtccacttggccttccagata
tacgaggcactgcgccccaggtacctagagataagagcagtaatggagcagatccctgaa
ataaacaaggagtctctggaccaatttgactgcaagcttctaaacccctcccttcaaaaa
gcagctgataaacgacggaaggaccacttcaaacgcctcatcgctggctgcattgggaaa
cccttgggagaacagttccgaaaagaagtccacattaagaaccttccctggcttttcaaa
aaatccaaaccaatgctggagacagaagtgctggacagtgaggagggtggactggccacc
atctttgaaccctga

DBGET integrated database retrieval system