KEGG   Rattus norvegicus (rat): 363235
Entry
363235            CDS       T01003                                 

Gene name
Als2
Definition
(RefSeq) alsin
  KO
K04575  amyotrophic lateral sclerosis 2 protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    363235 (Als2)
   05022 Pathways of neurodegeneration - multiple diseases
    363235 (Als2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    363235 (Als2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    363235 (Als2)
SSDB
Motif
Pfam: RCC1 MORN RCC1_2 VPS9 RhoGEF PH
Other DBs
NCBI-GeneID: 363235
NCBI-ProteinID: NP_001013431
RGD: 1310372
Ensembl: ENSRNOG00000023280
UniProt: P0C5Y8
Position
9
AA seq 1651 aa
MDSKKKSSAEAEGSKERGLVHVWQAGSFSLTPERLPGWGGKTVLQAALGVKHGVLLTEDG
EVYSFGTLPWKSEAAEICPSSPLLESALVGHHVVTVATGSFHSGAVTESGVVYMWGENAA
GQCAVANQQYVSEPSPVSISDSETSPLLAVRILQLACGEEHTLALSISREIWAWGTGCQL
GLITTTFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCLPPQDLKPVPERCNQCSQLLI
TMTDKEDHVIISDSHCCPLGVTLSESQAEKHASTVTSPHPETLDGQGEVFENTVAEAELN
MGSDQTTSGSAISAQQNIVGMAEVSSARTAPSYPDTQTVTAYLQKLSEHSVKENHEREEK
LPQVQPLVEEAVPDLHSPPTTSTSALNSLVVSCASAVGVRVAATYEAGALSLKKVMNFYS
TAPCEPGAPSGTASTGPESLKDLREEQVKQESLQGKKSSSLMDIREEESEGGSRRLSLPG
LLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKEGQLGHGDVLP
RLQPLCVKCLDGKEVIHLEAGGSHSLALTAKSQVYSWGSNTFGQLGHSEFPTTVPRLSKV
SSESGVWSVAAGHGYSLFLVDTEDFQPGLYYSGRQDRAEGDTLPENPSGTTTPVLLSCSK
LGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSEIKSQILRPLLSLEHL
GTVTTVQLLQEVASRFSKLCYLIGQHGASLSSYLQGMKEARNLVIMKHSSLFLDSYTEYC
TSVSNFLVMGGSQLLAKPAIDFLNKNQELLQDLSEVNDENTQLMEILNALFFLPIRRLHN
YAKVLLKLATCFEVTSPEYQKLQDSSSCYESLALHLGKKRKEAEYTLSFWKTFPGKMTDS
LRKPERRLLCESSNRALSLQHAGRFSVNWFILFNDALVHAQFSTHHVFPLATLWAEPLSE
ETGGVNGLKITTPEEQFTLISSTPQEKTKWLRAISQAVDQALRGTSDFPLYGGSSTVQRQ
EPPISRSAKYTFYKDTRLKDATYDGRWLSGKPHGRGVLKWPDGKVYSGTFRNGLEDGYGE
YRIPNKALNKEDHYVGHWKEGKMCGQGVYSYASGEVFEGCFQDNMRHGHGLLRSGKLTSS
SPSMFIGQWVMDKKAGYGVFDDITRGEKYMGMWQDDACQGNGVVVTQFGLYYEGNFHLNK
MMGNGVLLSEDDTIYEGEFSDDWTLCGKGTLTMPNGDYIEGYFSGEWGSGIKITGTYFKP
SLYESDKDRPKAFRKLGNLAVAADEKWRAVFDECWRQLGCESPGQGEVWKAWDNIAVALT
TNRRQHKDSPEILSRSQTQTLESLEYIPQHVGAFSVEKYDDIKKYLIKACDTPLHPLGRL
VETLVAVYRMTYVGVGANRRLLQEAVKEIKSYLKRIFQLVRFLFPELPEEGSTVPLSAPL
PTGRRSFCTGKSDSRSESPEPGYVVTSSGLLLPVLLPRLYPPLFMLYALDNDREEDIYWE
CVLRLNKQPDIALLGFLGVQRKFWPATLSILGESKKVLPSTKDACFASAVECLQQISTTF
TPSDKLKVIQQTFEEISQSVLASLQEDFLWSMDDLFPVFLYVVLRARIRNLGSEVHLIED
LMDPYLQHGEQGIMFTTLKACYYQIQREKLN
NT seq 4956 nt   +upstreamnt  +downstreamnt
atggactcaaagaagaaaagctcagcagaggcagaaggatccaaagaaagaggcctagtc
catgtctggcaggcaggatccttttctctaacaccagagaggttgccaggctggggagga
aaaacagttcttcaggcggcccttggcgtgaagcatggagttcttctgactgaagatggt
gaggtctacagctttgggacccttccctggaaaagtgaagcagcagaaatttgtccaagc
agcccccttctagaaagtgccctggttgggcatcatgttgttactgtggcaacagggagc
ttccacagtggagcggtgacagaaagtggagtggtgtacatgtggggggagaacgctgcc
gggcagtgtgcagtagcgaaccagcagtatgtgtcggaaccaagtcctgtcagcatttct
gactcggagaccagccccttgctagcagttaggattctgcagttggcatgtggcgaggaa
cacacactggcattgtcaatcagcagagagatctgggcatggggcaccggctgtcagctg
ggtctcatcaccaccaccttcccagtgacaaagccacaaaaggtggaacaccttgctgga
cgagtggtgctccaggtggcctgtggtgcgttccacagccttgcacttgtgcagtgcctc
cctccccaggatctgaagccagtcccagagagatgcaatcagtgcagccagctgctcatc
accatgacagacaaagaggaccacgtgataatatcagacagccattgctgccctttaggt
gtgacactgtctgaatctcaagcagaaaagcacgccagcactgtgaccagccctcacccg
gagacgctggatgggcaaggagaggtgtttgagaacacagtagcagaagctgaactgaat
atgggaagcgatcagaccacaagtggcagtgccatttccgcccagcagaacatcgtggga
atggctgaagtgtcttctgccagaacagctccctcatacccagacacccagacggtaact
gcatacctgcagaagctatcagagcattcagtgaaggagaaccatgagcgtgaggaaaag
ctaccccaggtccagcctcttgtagaagaagcagttcctgatcttcacagtccaccaacc
acaagcacctcagccctcaacagcttggtggtctcctgtgcatctgctgttggtgtgaga
gtggccgccacctatgaagctggggccttgtctctcaagaaagttatgaacttttatagc
actgccccctgcgagccaggagctccgtcaggcactgcctccacaggcccagaaagtctg
aaagatctcagagaagagcaggtgaaacaggaatcactacaagggaagaaaagctcaagc
ctcatggatatcagagaggaggagtcggagggagggagtcgaagactctccctcccagga
ttgttgtcgcaagtttcccccaggctcttaaggaaggccgccagggtgaaaacacggaca
gtggttctgactcccacgtacagtggagaagcagatgccctcctgccttcgctgagaaca
gaggtgtggacctgggggaaaggcaaggaagggcagctggggcacggcgatgtcctgccc
aggcttcagccgttgtgtgtcaagtgtctggatggtaaagaggtcatccacttggaggca
ggtggctcccactctctcgcactgactgcgaaatctcaggtttactcatggggcagtaat
accttcggtcagctggggcattctgagtttccaacaacggttcctcgactctcgaaggtt
agcagtgaaagtggagtctggagtgtagctgcaggccacggttattccctgtttttagtg
gacactgaagacttccagcctgggttgtattacagtggccgccaggaccgtgcagaaggt
gacaccctgccagagaatcccagtggtacaacgactccggtacttctctcctgtagtaag
cttggatatatcagcagagtgacagcaggaaaagatagctacctagccttggtggataag
aacatcatgggatacatcgccagcctccatgagttggctaccacagaaagacggttttac
tcgaaactaagtgaaatcaagtcacagatacttaggcctcttctcagtctggaacatttg
ggcactgtgaccactgtccagctgttgcaggaagtcgccagccggttcagcaagttgtgt
tacctcattgggcagcatggagcctcactgagcagctacctgcaaggcatgaaggaagcc
aggaacctggtcatcatgaagcactcgagtcttttcttggacagttacacagagtattgt
acatcagtttcaaattttctggttatgggaggatcccagcttcttgctaagcctgcaatt
gatttcctaaataaaaaccaagaactcttgcaagatttgtcagaagtgaatgatgagaac
actcagttgatggaaatactgaatgcgctgtttttcttgccaatcagacgacttcataat
tatgcaaaagttttgctaaagctcgccacttgctttgaagtgacatcaccagagtatcaa
aagctgcaggattccagttcttgttatgagtctcttgctctccatcttggcaagaagagg
aaggaagcagagtacacgctgagcttctggaagaccttccctggaaaaatgacggattcc
ttgaggaagccagagcgccggctgctgtgtgagagcagtaaccgagccctctccctgcag
catgctggcaggttttctgtgaattggttcattctcttcaatgatgccctggtccatgct
cagttctccacacaccacgtgttccctttggccacactctgggcagagccactttctgaa
gaaactggtggcgtgaatggcttaaagataaccacacctgaagaacagttcacgctcatt
tcttcaacaccccaggaaaagaccaagtggcttcgggctatcagccaagccgtggaccag
gctttgagggggacgtctgacttcccactttacggaggcagcagcactgttcagaggcag
gaaccacccatctcaagaagtgccaaatacactttctacaaggatactcgcctaaaggac
gccacttacgatgggcgctggctttcagggaagccgcacggaaggggtgttttgaagtgg
cctgatgggaaggtgtattctggcacgttcaggaatggcttggaagacggatatggtgaa
tacagaatcccaaacaaggccctgaacaaagaagaccattacgtgggccattggaaggag
gggaaaatgtgtgggcaaggagtgtacagctatgcctctggtgaagtgtttgaaggctgc
tttcaagataacatgcgccacgggcacggtctcctccgcagtggaaaactgacttcttcc
tctcccagcatgttcattggccagtgggtaatggacaagaaagcagggtatggcgtcttc
gatgatatcaccaggggagaaaagtacatgggaatgtggcaggacgatgcatgccaaggg
aatggggtggtggtcacccagtttgggttatactacgaaggcaacttccaccttaataaa
atgatgggaaatggggttttgctttcggaagatgatactatatatgaaggagaattttct
gatgactggacactttgtggaaagggaacactgactatgccaaatggagattatattgaa
ggttattttagtggagaatggggatctgggataaaaatcactgggacctacttcaaacct
agcctatatgagagtgataaggacaggcccaaagccttcaggaagctgggaaacctggcc
gtggccgccgatgagaaatggagagcagtgtttgacgaatgctggcgccagctgggctgt
gagagcccaggccaaggggaggtttggaaagcgtgggataatattgctgtggccttgacc
accaaccgtcgccagcataaagacagtccagaaatactaagccgttcacagactcagacc
ctggagagtttggagtacattccccagcacgttggcgccttctctgtggagaaatatgat
gatatcaagaagtatttaataaaggcctgtgacactcctctgcacccactgggcaggctt
gtggagaccctggttgcagtgtatagaatgacttatgtgggcgtaggggccaaccgtcgg
ttactgcaggaagctgtgaaggagattaagtcttatctcaagaggattttccaacttgtg
aggttcttgtttcctgagcttcctgaagagggcagcacagttcctctctctgctcctctg
cccactggaagaagatccttctgcactgggaaatcagattccagatccgagtcaccagag
ccaggttatgtagtaacaagttctggcttactgcttccggtgctgctgcctcggctctac
ccgcctctcttcatgctctatgccctggacaatgaccgagaggaagacatttactgggaa
tgtgtgcttcgactaaacaagcagccagatattgctctcctgggctttcttggagtacag
aggaaattctggccagcaaccttgtcaatccttggagagagtaaaaaggtactgccatcc
acaaaggatgcttgttttgcatctgcagtagaatgtctgcagcagatcagcacaacattt
actccatcagacaaacttaaagtgatccagcagaccttcgaagaaatctctcagagtgtg
ctggcgtcgctgcaggaggacttcctttggtccatggatgacttgttccctgtcttctta
tacgtggtgctgcgggccaggattcggaatttaggctctgaagttcatctcattgaggat
ctgatggacccctatctccagcatggggagcaaggcataatgttcaccaccttgaaggcc
tgttactaccagattcagcgtgagaagcttaactag

DBGET integrated database retrieval system