KEGG   Rattus norvegicus (rat): 363241Help
Entry
363241            CDS       T01003                                 

Gene name
Eef1b2
Definition
(RefSeq) eukaryotic translation elongation factor 1 beta 2
  KO
K03232  elongation factor 1-beta
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    363241 (Eef1b2)
Translation factors [BR:rno03012]
 Eukaryotic Type
  Elongation factors
   363241 (Eef1b2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF1_GNE EF-1_beta_acid GST_C_3 GST_C_6 GST_C_2
Motif
Other DBs
NCBI-GeneID: 363241
NCBI-ProteinID: NP_001102269
RGD: 1311415
Ensembl: ENSRNOG00000024186
UniProt: B5DEN5
Position
9q32
AA seq 225 aa AA seqDB search
MGFGDLKTPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAISGPPPADLCHALRWYNHIK
SYEKEKASLPGVKKSLGKYGPVSVADTTGSGAADAKDDDDIDLFGSDDEEESEDAKRLRE
ERLAQYESKKAKKPAVVAKSSILLDVKPWDDETDMTKLEECVRSIQADGLVWGSSKLVPV
GYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcggagacctgaaaacccccgccggcctccaggtgctcaacgattacctggcg
gacaagagctacattgaggggtacgtgccatcacaagccgatgtggcagtatttgaagca
atctctggtccaccacccgctgacctgtgtcatgctctgcgttggtataatcatatcaaa
tcttacgaaaaagaaaaggccagcttgccgggagtgaagaaatctttgggcaagtatggc
cctgtcagtgtggcagataccacaggaagtggagcagcagatgctaaagacgatgatgac
attgatctcttcggatctgatgatgaggaggaaagtgaagacgcaaagaggctacgagaa
gaacgccttgctcagtatgagtcaaagaaagctaaaaagcctgcagttgttgcgaagtct
tccatcttgttagatgtgaagccttgggacgatgagacagacatgacgaaacttgaggag
tgtgtccgaagcattcaagcggacggcttggtgtggggctcctctaaattggttccagtg
ggatacggaattaaaaagcttcaaatacagtgtgtagttgaagatgataaggttggaaca
gatatgctggaagagcagattactgcttttgaggactatgtacagtccatggatgtggct
gcttttaacaaaatctaa

DBGET integrated database retrieval system