KEGG   Rattus norvegicus (rat): 363247
Entry
363247            CDS       T01003                                 

Gene name
Xrcc5, Ku80, Kup80
Definition
(RefSeq) X-ray repair cross complementing 5
  KO
K10885  ATP-dependent DNA helicase 2 subunit 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    363247 (Xrcc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    363247 (Xrcc5)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     363247 (Xrcc5)
SSDB
Motif
Pfam: Ku_N Ku Ku_PK_bind Ku_C DUF2682
Other DBs
NCBI-GeneID: 363247
NCBI-ProteinID: NP_803154
RGD: 3976
Ensembl: ENSRNOG00000016105
UniProt: Q6P7P8
Position
9q33
AA seq 732 aa
MAWSGNKAAVVLCMDVGVAMGNSFPGEESPLEQAKKVMTMFVQRQVFSESKDEIALVLYG
TESTDNALAGKDQYQNITVHRHLMLPDFDLLEDIGNKIQPSSQQADFLDALIVCMDLIQR
ETIGKKFGKKHIEVFTDLSSPFSQDQLDIIICNLKKSGISLQFFLPFPIDKNGEPGETED
HDSSFDHCAPSFPQKGLTEQQKEGIHMVTRVMLSLEGKDGLDEIYSFSESLQQLCIFKKI
ERRSLPWPCQLTIGPNLSIRIVAYKSIVQEKFKKSWVVVDARTLKKEDIQKETVYCLNDD
DETEVSKEDTIQGFRYGSDIIPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVHRRFFMGHQ
VLKVFAAKDDEAAAVALSSLVHALDELNMVAIVRYAYDKRANPQVGVAFPFIKDAYECLV
YVQLPFMEDLRQYMFSSLKNNKKCTPTEAQLSAIDDLIDSMSLVKKNEEEDIIEDLFPTS
KIPNPEFQRLYQCLLHRALHLQERLPPIQQHILNMLDPPTEMKAKCEIPLSKVKTLFPLT
EVVKKKDQVTAQDVFQDNIEEGPAAKKYKTEKEEGHISISSLAEGNVTKVGSVNPVENFR
VLVRQKIASFEEASLQLMSHIEQFLDTNETLYFMKSMDRIKALREEAIQFSEEQRFNSFL
EGLREKVEIKQLNHFWEIVVQDGITLITKDESPGSSVTAEEATKFLTPKDKAKEDTTGLE
EGGDVDDLLDMI
NT seq 2199 nt   +upstreamnt  +downstreamnt
atggcgtggtccggtaataaggcagctgttgtgctgtgtatggatgtgggggttgccatg
ggtaactcctttcctggtgaagaatccccacttgaacaggccaagaaagtgatgactatg
tttgtccaacgacaggtgttttcggagagcaaggatgagatcgccttagtcctctatggt
acagagagcactgataacgcccttgctggcaaggaccagtatcagaacatcacagtgcac
aggcacctgatgctaccagattttgatttgctggaagacatcggaaacaaaatccaacca
agttctcaacaagccgacttcctggacgccctgattgtgtgcatggatttgattcagcgt
gaaaccataggaaagaagtttgggaagaagcatattgaagtgttcactgatctcagcagc
ccattcagccaagaccaactggacattataatttgtaacctgaagaagtccggcatctcc
ctgcagttctttctgccttttccaatcgacaagaatggtgagcctggggagacagaagac
cacgactccagcttcgaccactgtgcaccctccttccctcaaaaaggacttactgagcag
caaaaggaaggcatccacatggtgacgagggtgatgctgtctttagaaggcaaagatggt
ctggatgaaatttattccttcagcgagagtcttcagcaactgtgcatctttaagaagatt
gagaggcggtccttgccctggccctgccaactgaccatcggccccaacttgtctataagg
atcgtagcctataaatcgattgtacaggagaaatttaaaaagagttgggtagttgtggac
gcaagaactctaaagaaggaagatatacaaaaagagactgtttattgcctaaatgacgat
gatgaaactgaagtttccaaagaggacactattcaagggttccgctatggaagcgacatc
attcctttttctaaagtggatgaggaacaaatgaaatataaatcggaggggaagtgcttc
tctgttctggggttctgtaaatcttctcaggttcatagaagattcttcatgggacatcaa
gttctgaaggtcttcgcagcgaaggatgatgaggcagcagctgttgcactttcttcccta
gttcacgctttggatgagttaaacatggtcgctatcgtccgctacgcctatgacaaaaga
gctaatcctcaagttggtgtagccttccctttcattaaggatgcctatgagtgtttagtt
tatgtgcagctgcctttcatggaagacttgcggcaatacatgttttcctcactgaaaaac
aataagaagtgcacccccacagaggcacagctgagtgcgatcgatgatctgattgattcc
atgagcttggtaaagaaaaacgaggaagaagacatcatcgaagacttgtttccaacctcc
aaaattccaaatcctgaatttcagcggttgtaccagtgtctgctgcacagagccttacat
ctccaggagcggctgcccccaattcagcagcacattttgaatatgctggatccccccact
gagatgaaagcaaaatgtgagattccactctctaaagtaaagacccttttccctctgacg
gaagtcgttaagaaaaaggaccaagtgactgctcaggacgttttccaagacaatattgaa
gaggggcccgctgctaaaaaatacaagactgagaaagaagaaggtcacatcagcatctcc
agcctggcagaagggaatgtcaccaaggttggaagtgtgaatcctgttgaaaacttccgt
gtcctagtaagacagaagattgccagctttgaggaagcgagtctccagctaatgagtcac
attgaacagtttttggataccaatgaaacactgtattttatgaaaagtatggaccgcatc
aaagctctccgggaggaagccattcagttttcagaggagcagcgtttcaacagtttcctg
gaaggccttcgagagaaagtggaaattaaacaattaaatcatttctgggaaattgtcgtg
caggatggaattactctgatcaccaaagacgaaagcccaggaagctctgtcacagctgag
gaggccacgaagttcctgacccccaaagacaaagcaaaagaagacacaacaggacttgaa
gaaggtggtgatgtggatgatttactggacatgatatag

DBGET integrated database retrieval system