KEGG   Rattus norvegicus (rat): 363251
Entry
363251            CDS       T01003                                 

Gene name
Nhej1
Definition
(RefSeq) non-homologous end-joining factor 1
  KO
K10980  non-homologous end-joining factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    363251 (Nhej1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    363251 (Nhej1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     363251 (Nhej1)
SSDB
Motif
Pfam: XLF
Other DBs
NCBI-GeneID: 363251
NCBI-ProteinID: NP_001014239
RGD: 1359338
Ensembl: ENSRNOG00000018162
UniProt: Q6AYI4
Position
9
AA seq 304 aa
MEELEQGLLMQPWAWLQLAENSLLAKASITKHGYALLISDLQQVWHEQVDTLEVSQRAKE
LNKRLTAPPAAFLHHLDEVLRPLFKDSAHQDAAHPSKATFSCDRGEEVLILRVRSELSGL
PFNWHFHCLPASSLLVSQHLICPLMGVSLALHSHVRELAALLRMKDLEIQAYQESGAVLS
RGRLKTEPFEENSFLEQFMVEKLPEACAVGDGRPFAMNLQSLYVAVTKQQVQARQKHKGS
GEPQTSSSTSPQGTDSQLQNQPEQQISPTPTLSEPECEPMAASGPVHRAQLVKAKRKKPR
GLFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggaggaactagagcaaggcctgttgatgcagccatgggcatggttacaacttgctgag
aactcactcttggccaaggcttctatcaccaagcatggttatgccttgctgatttcggat
cttcaacaggtgtggcatgaacaggtggacactttggaggtcagccagcgagccaaggag
ctgaacaagcgcctcaccgctccccctgcagcttttctccatcacttggatgaagtgctt
cgcccactgtttaaagattctgcccaccaggatgctgctcaccctagcaaagccactttc
tcctgtgatcgtggagaggaggtattgatcctgagggtgcggagtgagctctctggtctc
cccttcaattggcatttccactgtcttccagctagttctttactggtctctcagcatttg
atttgtcctctgatgggtgtgagcttggcattgcacagtcatgtgagggagctagcagca
ttgcttcggatgaaggaccttgagatccaggcctaccaggagagtggggctgtgctgagc
cgaggtcgattgaagacagagccatttgaagaaaattctttcttggaacagtttatggta
gagaaattgccagaggcatgtgctgttggtgatggaaggccatttgccatgaatctgcag
agcctgtatgtggcagtcacaaagcagcaggtccaagccaggcagaagcataaaggctct
ggagagcctcagacatcaagcagcacctcccctcaaggaactgatagccagcttcagaac
cagccagaacagcagatctctcccactccaaccctctcagagcctgaatgtgagcctatg
gctgcttcaggccctgtgcatagagctcagctggtaaaggccaagaggaagaagcccagg
ggactcttcagttag

DBGET integrated database retrieval system