KEGG   Rattus norvegicus (rat): 363269Help
Entry
363269            CDS       T01003                                 

Gene name
Sp100
Definition
(RefSeq) SP100 nuclear antigen
  KO
K15413  nuclear autoantigen Sp-100
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    363269 (Sp100)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    363269 (Sp100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSR
Motif
Other DBs
NCBI-GeneID: 363269
NCBI-ProteinID: NP_001014242
RGD: 1359550
UniProt: Q5XI80
Position
9q35
AA seq 342 aa AA seqDB search
MEGNSFSSRMSSEHENTETFPFELIFQHFKRQKVAISNAIKNPFPFLEGLRDHELITAKM
YEDLQDSYRALVRVQEVIYRALDKLEKIFSMKVLYEVFSNVNMEKYPDLQLIYQSFERVL
PNGLCFQRSDGGDPNSQLSLEQGPNGSCSQATLTLSPFNHSFSDGWGSNDRLNSSLTHGN
QSENHQLPGSPNHLGAVQLNHDLQINPCSVRLVDIKKENISYSLDDNQQTQARTNENQGS
EIIELSSDEDSNDEINLSEASTLILSKPETAHSRQPPTPRTYRRGDTSDTSSSSLDRRRK
RTGRMLSSSSSELSSGEESEEFLRSGSGRLGCPASAHWMAGV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggaagggaacagcttcagctccaggatgtccagtgaacatgagaatacagagacgttt
ccctttgaacttatatttcaacacttcaagagacagaaagtggcaatttctaatgcaata
aaaaatccatttccttttcttgagggcctccgagatcatgaattaatcactgctaaaatg
tatgaagatcttcaagattcgtatagagccctggtccgtgtacaggaagtgatctacaga
gccctggataaactggagaagatattcagcatgaaggtcctctatgaagtattcagtaat
gtcaacatggagaaatatccagatttgcaactcatttatcaaagctttgaacgtgtgtta
ccaaatggattgtgtttccaaaggagtgatggaggagacccaaactcccagctgagtctt
gaacaaggacctaatggcagctgttctcaagcaaccctgaccttgtcacccttcaatcac
tccttttctgacggctggggaagtaatgatagactaaattccagcctcacccatggaaac
caaagtgagaatcatcaactccccggatcaccaaatcaccttggagctgtgcaactcaac
catgacctccaaattaatccctgttctgtgcggctggtagatataaagaaggaaaatata
tcatattctttggatgataaccaacagacccaagcaaggactaacgaaaatcagggctct
gagataatagagctcagcagtgatgaggattctaatgatgaaatcaacttgtcagaagcc
tctaccttaatcctctccaagccagagactgcacattccagacaacctcccacaccaaga
acatacagaagaggagatacttctgataccagcagctcaagcctcgatagaagacggaaa
aggacaggacgaatgttgagtagctcctcttctgaactgagttctggagaggaatctgag
gaatttctaagaagtggatcaggaagattaggatgcccagcctcggcccactggatggca
ggagtttga

DBGET integrated database retrieval system