KEGG   Rattus norvegicus (rat): 363278Help
Entry
363278            CDS       T01003                                 

Gene name
Atg16l1, Apg16l, Wdr30
Definition
(RefSeq) autophagy related 16-like 1
  KO
K17890  autophagy-related protein 16-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04136  Autophagy - other
rno04140  Autophagy - animal
rno04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    363278 (Atg16l1)
   04136 Autophagy - other
    363278 (Atg16l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    363278 (Atg16l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    363278 (Atg16l1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    363278 (Atg16l1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    363278 (Atg16l1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    363278 (Atg16l1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    363278 (Atg16l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 Ge1_WD40 KASH_CCD Fez1
Motif
Other DBs
NCBI-GeneID: 363278
NCBI-ProteinID: NP_001102279
RGD: 1310631
Ensembl: ENSRNOG00000017913
UniProt: D3ZFK6
Position
9q35
AA seq 607 aa AA seqDB search
MSSGLRAADFPRWKRHIAEELRRRDRLQRQAFEEIILQYTKLLEKSDLHSVLTQKLQAEK
HDVPNRHEISPGHDGAWNDSQLQEMAQLKMKHQEELTELHKKRGELAQLVIDLNNQMQQK
DKEIQTNEAKIAECLQTISDLEADCLDLRTKLQDLEVANQTLKDEYDALQITFTALEEKL
RKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDI
EVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSIPVPQDVVDT
HPASGKDVRVPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEFKG
SLSGSNAGITSIEFDSAGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDN
ARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSES
VVREMELLGKITALDLNPERTELLSCSRDDLLKIIDLRTNAIKQSFSAPGFKCGSDWTRV
VFSPDGSYVAAGSADGSLYVWSVLTGKVEKVLSKQHSSSINAVAWAPSGLHVVSVDKGSR
AVLWAQP
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggcctccgcgccgcagactttccccgctggaagcgccacatcgcggaggaa
ctgaggcgccgggaccggctgcagaggcaggcgttcgaggagatcattctgcagtatacc
aagttgctggagaagtcagatcttcattcagtattgacccagaaactacaggctgaaaag
cacgacgtaccaaataggcatgaaataagtcctgggcacgatggtgcatggaatgacagt
cagctacaagaaatggcccagttgaagatgaaacaccaggaagagctgactgaactgcac
aagaagcgtggggagttagctcagttggtgattgacctgaataaccagatgcagcagaag
gacaaggagatacagacgaatgaagcaaagattgcagagtgtttacagaccatctctgac
ctggaggcagactgcctggacctgcgcaccaaactgcaggaccttgaggtagccaaccag
accctgaaggatgagtatgatgccctgcagattacttttactgccctagaagagaaactg
aggaaaactactgaggagaaccaggaactggtcaccaggtggatggctgagaaggcccaa
gaagccaatcgccttaatgcggagaatgagaaggactccaggaggcgacaagcacggttg
cagaaggagcttgcagaagcagcaaaggaacctctacctgtcgaacaggatgatgacatt
gaagtcattgtagatgagacctcagatcacacagaagagacctctcctgtgcgagccatc
agcagagcagctactaagcgactctcgcagcctgctggaggccttctggattctatcact
aatatctttgggagacgctctgtctcttccatcccagtcccccaagatgtcgtggacact
catcctgcttctggtaaagatgtgagagtcccaactactgcctcgtatgtctttgatgca
catgacggagaggtcaatgcagtacagttcagtccaggctcccggttactggccactgga
ggcatggaccgcagggttaaactttgggaagcattcggagataaatgtgaattcaagggc
tccctgtctggcagcaatgcgggaattacaagcattgaatttgatagtgctggagcttac
ctattagcagcttcaaatgattttgcaagccgaatctggactgtggatgattatcgatta
cggcacacacttaccggccacagcgggaaagttctctctgccaagttcctgctggacaat
gcacggatagtctcaggaagtcatgaccggaccctcaaactctgggatctccgcagcaaa
gtctgtatcaaaacagtgttcgcagggtccagctgcaatgacattgtttgcactgagcaa
tgtgtaatgagtggacattttgacaagaaaattcgtttctgggatatccggtcagagagt
gtggtccgagagatggaactgttagggaagatcactgctctggacttaaaccccgagagg
actgagctcctgagctgctcccgtgatgacctgctaaaaatcattgacctgcggacaaac
gccatcaagcagtcattcagtgcacctggattcaagtgtggctctgactggacccgagtt
gtcttcagccctgatggcagttacgtggcagcaggctcagctgacggctctctttatgta
tggagtgtgctcacggggaaagtagagaaggttctctccaagcagcacagctcttctatc
aatgcggtggcgtgggccccctctggcttacatgttgtcagtgtggacaaaggaagcaga
gctgtgctatgggcacagccttga

DBGET integrated database retrieval system