KEGG   Rattus norvegicus (rat): 363289
Entry
363289            CDS       T01003                                 

Gene name
Mterf4
Definition
(RefSeq) transcription termination factor 4, mitochondrial
  KO
K15032  mTERF domain-containing protein, mitochondrial
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    363289 (Mterf4)
   03029 Mitochondrial biogenesis [BR:rno03029]
    363289 (Mterf4)
Translation factors [BR:rno03012]
 Eukaryotic type
  Release factors
   363289 (Mterf4)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    363289 (Mterf4)
SSDB
Motif
Pfam: mTERF DUF2052
Other DBs
NCBI-GeneID: 363289
NCBI-ProteinID: NP_001032286
RGD: 1562440
Ensembl: ENSRNOG00000037376
UniProt: Q4G078
Position
9
AA seq 347 aa
MASLGRQVPEWHRLMALSWACLARQTCHFRKEKKMSPSLFCKLTTVPSRGNFQEFSSVRP
KKYMQEPEHRTRLVPCLHEEQRTCMGSESLELERAISSLQDMGFAEAHIDSLLNIQPSVH
PQQLLDIISELLLLGLNPEPVFMALKKNPQLLKLSATQMKRRSSYLRKLGLGEGKLKRVL
SVCPKVFTMRQQDIDNIVKVLKEKCLFTVQHITDILHRCPAVLQEDPSELEYKFQYAYFR
MGLTHLDIVRTDFLQYSIAKVKQRHIYLERLGRYQTPDKKGQTQIPNPSLKNILRVSEAE
FLARTACSSAEEFEVFKKLLDQEEEESESHMSEEEEEEEEEEEEELP
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggcttcgctgggaaggcaggttcctgaatggcatcgtctaatggccctttcctgggcc
tgtttggctaggcagacctgtcatttcagaaaagagaaaaagatgagtccttctttgttt
tgtaaactgactacagtacccagtagagggaactttcaagagttttccagcgttagaccc
aaaaagtacatgcaggaaccagaacacaggacacgtcttgttccgtgtcttcatgaggaa
cagaggacatgtatgggttctgagtccttggagcttgaaagggccatcagttccctccag
gacatgggttttgctgaagcccatattgacagcttgctcaatatacaaccaagtgtccat
cctcaacagttgctggacataatttcagaacttctactcttggggttgaacccagagcct
gtatttatggccttgaagaaaaatccccagttgctgaaactgtctgccacgcaaatgaag
aggcgttccagttaccttcggaagctcggccttggagaagggaaactgaagcgggtgctt
tctgtttgccctaaggttttcaccatgcgtcagcaggacattgataatattgtaaaagtc
ctcaaggagaagtgcttgttcacagtacagcacatcactgacattctgcacagatgccca
gctgttttgcaggaggaccccagtgagctagaatacaaattccagtatgcatatttcagg
atgggactgacacatctagacatcgtcaggaccgatttcctacagtattcaatagccaag
gtcaagcagagacacatttacttggagcgccttggacggtaccaaacccctgataagaag
gggcagacacagatccctaatccctcactgaagaacattctcagagtttctgaagctgag
tttttggccaggacagcctgttcctctgctgaggagtttgaagtttttaaaaagctcttg
gatcaagaggaggaggagtctgagagccatatgtctgaggaggaggaggaggaagaggaa
gaagaggaggaggagctgccgtga

DBGET integrated database retrieval system