KEGG   Rattus norvegicus (rat): 363328
Entry
363328            CDS       T01003                                 

Gene name
Ticam1
Definition
(RefSeq) TIR domain-containing adapter molecule 1 isoform X1
  KO
K05842  toll-like receptor adapter molecule 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno05133  Pertussis
rno05135  Yersinia infection
rno05142  Chagas disease
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    363328 (Ticam1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    363328 (Ticam1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    363328 (Ticam1)
   04621 NOD-like receptor signaling pathway
    363328 (Ticam1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    363328 (Ticam1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    363328 (Ticam1)
   05160 Hepatitis C
    363328 (Ticam1)
   05164 Influenza A
    363328 (Ticam1)
   05168 Herpes simplex virus 1 infection
    363328 (Ticam1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    363328 (Ticam1)
   05165 Human papillomavirus infection
    363328 (Ticam1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    363328 (Ticam1)
   05133 Pertussis
    363328 (Ticam1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    363328 (Ticam1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    363328 (Ticam1)
SSDB
Motif
Pfam: TRIF-NTD RHIM TIR_2
Other DBs
NCBI-GeneID: 363328
NCBI-ProteinID: XP_008765024
RGD: 1590868
Position
9
AA seq 734 aa
MPKRTHLSQRSALSPSRILVAGDKAVHKTIGSEHVSIHPTLCGSRLHPPPSMTNPAPSLH
SVFGILSALERDRLTCLKHKLGSLHPGSLESKLLHAMVLLALGQDTEARVSLESLKVNTA
AQLVAGQWADMENTEDPEEPPDLSWTVARLYHLLAEENLCPASTRDVAYQVALRDLTSQG
DHQLGQLQKEAWDRCSSHQGSLQPPSAAPAMTRSQPRPIDTSDWSWGHTLHSTGSTATLA
SHLEISQSPTLAFFSSHHGAHGPSKLCDKPLGTQEPQLVPEGCEEPDRSQPPPVQTSISL
GLPHEIRVPEVALPILPDSLAAPNTSVHCPIECTEVSADSRSPLTSITESVGKQWPITSQ
RSPQFPVGDDVLPNSMSSSPPAQPPSSQASSVQPPLSSASSQSSCPAPPASTPPVSEHLE
TSDQKFYNFVVIHARADEHVALRIREKLETLGVPDGATFCEEFQVPGRGELHCLQDAIDH
SGFMILLLTASFDCPLSLHQVNHALMNSLTQSGRQDCVIPLLPLECSQAQLSPDTTRLLH
SIVWLDEHSPIFARKVANTFKAQKLQAQRERWKKEQEARTLKEQSTQLEAERQRVAAISA
AYSAYVHGYTAWQTEMNRLGVAFGKDLSLGPPTPFPSWPGFPKPMPSHPQGCTPVSPYSP
RQPPSSSLSQSFSPASSPAPQTPGPQPLIIHHAQMVQLGVNNHMWGHTGAQSSDDKTEFG
ETLDGPSDRGEPLS
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgccgaaaaggacccatctaagccagaggtctgcactgtcaccctccaggatccttgtg
gcaggggacaaggctgtgcataagacaattggttcggaacatgtctccatccaccccact
ctctgtggctccaggcttcatcctcccccatccatgaccaacccagccccgtcactccat
agtgtctttggcattctaagtgccttggaaagggacaggctgacctgtctgaaacacaag
ctggggagtctgcatccaggcagcctggagtcaaaacttctccacgccatggtactcctg
gctctgggccaggacacggaggccagggtctctctggagtccttgaaggtaaatacagca
gcgcagctggtagctggccagtgggcagacatggagaacacagaggaccctgaggagcct
ccagacttgtcctggacggtggctcgcctgtaccacctgctggctgaggagaacctgtgc
ccggcctccacaagggatgtggcttaccaggtggcccttcgtgacctcacctcccagggt
gaccaccagctgggccaactccagaaggaggcctgggatcggtgtagttctcatcagggt
tccctgcagccaccatcagctgcccctgcaatgactagaagtcagcctcgccccattgac
acatcagactggagttggggacatacgttacactccaccggcagcactgccacactggcc
agtcacctagagatcagccagtcgcccactctggcctttttctcttcacaccatggagcc
catgggcccagcaagctatgcgacaaaccactgggcactcaggagcctcagcttgtccct
gaaggctgcgaagaacctgacaggagccagcctccaccagtgcagaccagtatctctttg
gggttaccacacgaaattagggtcccagaggtggctttgcccatcctccctgactctctg
gctgctccaaacacaagtgtccactgtcccattgaatgcacagaggtgtctgcagactct
aggtctcccctgacatccatcacagaaagtgttggaaagcagtggcctatcacaagtcag
aggtcacctcagtttccagtaggagacgatgttctgccgaactccatgtcatccagccct
cctgcccagccaccgtcttcccaagcctcctctgtgcagccccctctgtcctctgcttcc
tcccagagcagctgccctgctcccccagcctccacaccccctgtttcggaacacttggaa
acatctgatcagaaattctataactttgtggtcatccatgccagggctgatgaacatgtg
gccctacgtattcgggagaagctagagacccttggggtacctgatggggccaccttctgt
gaggaatttcaggtgcctgggcgtggtgagctgcactgtctccaagatgccatcgatcac
tcagggttcatgatcctgctcctgactgccagctttgattgtcccctaagcctgcatcaa
gtcaaccatgctctcatgaacagcctcacccagtctgggaggcaggactgtgtgatcccc
ctcctcccacttgagtgctcccaggctcagctcagcccagacacaaccagactgctccat
agtattgtgtggctggatgagcactccccaatctttgccagaaaggtggcaaacaccttc
aaagcacagaagctccaggcacagcgcgagcgctggaagaaagagcaggaagccagaacc
ctcaaggagcagagcacacagctggaggctgagcggcaaagggtggctgccatatctgca
gcctactcagcctatgtccatggctacacagcctggcaaacagaaatgaacagacttggg
gtggcctttgggaaggacttgtcactggggcccccaacacctttccccagctggccaggg
tttccgaagccaatgccttcccatcctcagggttgtactccagtttccccctattctccg
aggcagcctccgtcctcttccctatcccaatccttttcaccagcctcctccccagccccc
cagactccaggacctcagcctctaattattcatcatgcccagatggtacagttgggagtt
aacaaccacatgtggggccacacaggggcccagtcatctgatgacaagactgagtttgga
gaaaccttggatgggccctctgaccgaggggaacccctttcttga

DBGET integrated database retrieval system