KEGG   Rattus norvegicus (rat): 363334Help
Entry
363334            CDS       T01003                                 

Gene name
Stap2
Definition
(RefSeq) signal transducing adaptor family member 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: SH2
Motif
Other DBs
NCBI-GeneID: 363334
NCBI-ProteinID: NP_001020197
RGD: 1566020
Ensembl: ENSRNOG00000047306
UniProt: Q5BK28
Position
9q12
AA seq 380 aa AA seqDB search
MASALCPPRGPKLKGAPPSHYYENFLEKKGPCDQDYRKFWAGLQGLAICFYNSNRDLQPL
EKLDLRLFSKLKDEALLGSSHDTTYHFSLVLRDQEVKFKVESLESCEMWKGFILTVVELR
VPSNLTLLPGHMYMMAEVLAKEEVRRAAEVPWCFLQVSRLEAQLLLERYPECGNLLLRPG
GDGKDSVSVTTRQILNGSPVIKHYKVKREGSKYVIDVEDPFSCPSLEAVVNYFVTHTKRA
LVPFLLDEDYEKVLGFVDSDRENGENAWTVPSSRGSGPALPANVPKPLPPVPVSVSSQED
KLPQLPPLPQLPDQDENYVTPIEDSLATEYMNRDDLKAITNIWTRKLGGSSPQASSLVTR
LGDITAELEEKLQKRRALEH
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagccctgtgtccaccccggggccccaagctcaaaggtgctccaccttcccac
tactacgagaacttcctagagaaaaagggaccctgtgaccaggattacaggaagttctgg
gcgggcctccagggtttagccatctgtttctacaacagcaatcgggacttgcagcccctg
gaaaagctggacctgaggctgttttcaaagctcaaagatgaggctctgttgggaagctca
catgacactacctatcacttcagcctggttctccgggaccaggaggttaaattcaaggtg
gagagcctggagtcttgtgagatgtggaaaggatttatcttgactgtggtggagctccgt
gtcccatctaacctgaccctgctgcccggacacatgtacatgatggctgaagtcctggcc
aaagaggaagtacgaagggcagccgaggtgccctggtgctttctgcaggtgagcaggcta
gaggcgcagctgctcctggagcgctacccggagtgcgggaacctgcttctgcgacctgga
ggggatggcaaggacagtgtgtctgtcactacccggcagatactcaatgggtcgccggtg
atcaaacactacaaggtgaagcgagaaggttctaagtatgtcatcgacgtagaagacccg
ttttcctgcccctccctggaagctgtggtcaactattttgtgacgcacaccaagagggcg
ctggtccccttcctgttagatgaggactatgagaaggttctaggcttcgtggattcggat
cgggagaatggcgagaatgcatggactgtgccctcctcccgaggctcaggccctgccctc
cctgctaatgtcccaaagccactcccacctgtacctgtgtctgtgtccagccaggaagac
aagctgcctcaactacctcccctgcctcagttaccagaccaggatgagaactatgtgact
cccattgaagactccctagcaactgaatacatgaatcgggatgatctcaaggccattacc
aacatctggaccaggaaactaggtggaagctcaccccaggcttcctcccttgtgacaaga
cttggggatatcaccgctgagctggaagagaaactacagaagaggagggcactggaacac
tga

DBGET integrated database retrieval system