KEGG   Rattus norvegicus (rat): 363441Help
Entry
363441            CDS       T01003                                 

Gene name
Ndufa1, RGD1560955
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A1
  KO
K03945  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    363441 (Ndufa1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    363441 (Ndufa1)
  09159 Environmental adaptation
   04714 Thermogenesis
    363441 (Ndufa1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    363441 (Ndufa1)
   05012 Parkinson disease
    363441 (Ndufa1)
   05016 Huntington disease
    363441 (Ndufa1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    363441 (Ndufa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MWFE
Motif
Other DBs
NCBI-GeneID: 363441
NCBI-ProteinID: NP_001102283
RGD: 1560955
Ensembl: ENSRNOG00000052226
Vega: OTTRNOG00000002022
UniProt: G3V9S6 B4F7B9
Position
Xq35
AA seq 70 aa AA seqDB search
MWFEILPGLAIMGVCLVIPGVSTAYIHKFTNGGKEKRVARVHYQWYLMERDRRISGVNRY
YVSKGLENID
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcgagattctccctggcctcgccattatgggggtgtgcctggtcatccccggg
gtgtccactgcgtacatccacaagttcaccaacgggggcaaggaaaagagagttgctcga
gttcattaccaatggtatttgatggaacgcgatagacgcatctctggtgtcaatcgctac
tatgtgtccaagggcctggagaacattgactaa

DBGET integrated database retrieval system