KEGG   Rattus norvegicus (rat): 363462
Entry
363462            CDS       T01003                                 

Gene name
Gemin8, Fam51a1
Definition
(RefSeq) gem (nuclear organelle) associated protein 8
  KO
K13136  gem associated protein 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    363462 (Gemin8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    363462 (Gemin8)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    363462 (Gemin8)
SSDB
Motif
Pfam: GEMIN8 DUF2572
Other DBs
NCBI-GeneID: 363462
NCBI-ProteinID: NP_001007757
RGD: 1359160
Ensembl: ENSRNOG00000029038
UniProt: Q6AY77
Position
Xq14
AA seq 239 aa
MASKWRATTSWYSHPVYARYWQHYYHAMLWMQSHQNAYRKFRDSYFTSPWFFPHGVQPWS
SFAYETGHPWNSEGQHMEWQESPYSVSHPRSFEQPLYNSRRSQASAREDEEALCEEEELE
SDSDDEVECDLSNMEITEELRQYFAQTERHREERRRQQQLDEERLNDYVNADHGLYFNHH
RSVEPPSEKPWERRQAEMKRLYGNSAPKILAMEAAVQLSFDKHCDRKQPKYWPVIPLKF
NT seq 720 nt   +upstreamnt  +downstreamnt
atggcctcaaaatggagggctactacatcttggtattctcacccagtatatgcaagatac
tggcaacattattaccatgcaatgctctggatgcagagccaccagaatgcttacagaaag
ttcagggattcctatttcacttccccatggttcttccctcatggagttcaaccctggagc
tcctttgcttatgagactggacatccttggaattctgaaggtcagcacatggagtggcag
gagtctccctacagtgtttcccatcccagaagcttcgagcagcctctgtataacagccgt
agaagccaggcatccgcaagagaagatgaagaagccctgtgtgaagaggaagagctggag
tcggattcggatgacgaagtcgagtgtgacctgagcaatatggagatcactgaggagctc
cgccagtacttcgcacagaccgagaggcacagagaagagcgacggcgacagcagcagctg
gacgaggaacgtctgaatgactatgtgaatgcagaccacggcctgtacttcaaccaccac
aggtcagtggagcccccgtctgagaagccctgggagcggcgtcaagcagagatgaagcgc
ttatatggaaacagtgctcccaagatcctggccatggaggctgctgttcagctgagcttt
gacaagcactgtgacagaaagcagccgaagtactggcctgtcatccccctgaagttctga

DBGET integrated database retrieval system