KEGG   Rattus norvegicus (rat): 363469
Entry
363469            CDS       T01003                                 

Gene name
Sms
Definition
(RefSeq) spermine synthase
  KO
K00802  spermine synthase [EC:2.5.1.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno00330  Arginine and proline metabolism
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    363469 (Sms)
   00330 Arginine and proline metabolism
    363469 (Sms)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    363469 (Sms)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.22  spermine synthase
     363469 (Sms)
SSDB
Motif
Pfam: Spermine_synth SpmSyn_N Spermine_synt_N DUF43 Citrate_bind
Other DBs
NCBI-GeneID: 363469
NCBI-ProteinID: NP_001029071
RGD: 1564826
Ensembl: ENSRNOG00000007688
UniProt: Q3MIE9
Position
X
AA seq 366 aa
MAAARHSTLDFTLGAKADGEAILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFAN
LRIYPHGLVLLDLQSYDSDVQGKQETDCLLNKIEEKMKELSQDSTGRVKRLPPIVRGGAI
DRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRA
IMGNGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRRTCGDV
LDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILD
LSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTV
WKKAKP
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggcagcagcaaggcacagcacgctcgacttcacgctcggcgccaaagctgatggtgag
gccattctgaaaggccttcagtccatctttcaggagcaggggatggcagagtcggtgcac
acctggcaggaccatgggtatttagcaacctacacgaacaagaatggcagctttgccaat
ttgagaatttatccacatggattggtgttgctggaccttcagagttacgacagtgatgtg
caaggcaaacaagaaactgactgccttttgaataaaatagaagaaaaaatgaaagaattg
agtcaagacagtactggtcgggtgaagcgattaccacccatagttcgaggaggggccatt
gacagatactggcctactgctgacgggcgcctggttgagtatgacatagatgaagtggtg
tatgacgaagactcaccttatcagaacattaaaattcttcactcaaagcagtttgggaat
attctcatcctcagcggggatgttaatttggcagagagtgacttggcatataccagggcc
atcatgggcaatggtaaagaagactacactggcaaagatgtactgattctgggaggcggc
gatggaggcatattatgtgaaattgtcaaactgaaaccaaagatggtcactatggtagag
attgaccagatggtaattgatggatgtaagaaatacatgcgcagaacatgtggagatgtc
ttagacaatcttaaaggagattgctatcaggttcttatagaagactgtattccagtactg
aagaggtacgccaaagaagggagagagtttgattatgtgattaatgatttgacagctgtc
cctatctctacatctccagaagaagattccacatgggagtttctcagactgattcttgac
ctgtcaatgaaggttctgaaacaggatggaaaatatttcacacaggggaactgtgtcaac
ttgactgaagccctgtcgctctatgaagaacagctggggcgcctgtattgtcctgtggaa
ttctcaaaagagattgtctgtgtcccttcatacttggaattgtgggtattttacactgtt
tggaagaaagctaagccttaa

DBGET integrated database retrieval system