KEGG   Rattus norvegicus (rat): 363493Help
Entry
363493            CDS       T01003                                 

Gene name
Taf7l, RGD1564898
Definition
(RefSeq) TATA-box binding protein associated factor 7-like
  KO
K03132  transcription initiation factor TFIID subunit 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    363493 (Taf7l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    363493 (Taf7l)
   03036 Chromosome and associated proteins [BR:rno03036]
    363493 (Taf7l)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     363493 (Taf7l)
   Coactivators
    SAGA/TFTC/STAGA complex
     363493 (Taf7l)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     363493 (Taf7l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TAFII55_N ORC_WH_C SDA1
Motif
Other DBs
NCBI-GeneID: 363493
NCBI-ProteinID: NP_001129349
RGD: 1564898
Ensembl: ENSRNOG00000026315
UniProt: D4AC01
Position
Xq32
AA seq 465 aa AA seqDB search
MERGEEAPVEGAPTERAPAEGALAEAALPKAALAEAGAPDISEAPSTHAPTSEETGPKEP
QVPISLGAESACDTSDTGGARGLVIPVPSRAEPHGTRPSTARGRALQKAMRAMSLRHEES
HEIEEQFILRLPPVTDGHHAVVQVENVSLPAKLVNLPCVIGSLKTVDRKTFYQTADISQM
LVCSPEGEPHSSPEEPVISTGPTVTGHIEGKAEKKKYNWKHGITPPLKNVRKKRFRKTTK
KLPDVKQMDEINFSEYTQSPSVEKEVKRLLCSDAEAVSVRWEVVADDDTKEIESQGCIST
TSGTPQMGGAGSSEYDVLREMMGETGSNSNDVEDKNSKIEDEDEDDQEDEDEDDGNEEKE
EETDNSEEELEKELQAKFIQSSLHEKEQDYTSIIMEIQKLIHIKEQKLQQIYKKAQRQKD
LLRNVENLTLKRHFQNVLEKLNILEKEKCEQIYHLQEQLKCFLKE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcggtgaggaagcacccgttgagggtgctccgactgaaagagctccggctgag
ggagctctcgctgaggcagctctccccaaggcagctctcgctgaggcgggggcccccgat
atttctgaagccccctcaacacatgctccaacatctgaagaaacgggccccaaagagccc
caagttcctatcagccttggcgctgaaagtgcttgcgacacatctgacactggaggtgct
cgaggcctagtgattcctgttcctagtagggccgagcctcatgggacccgcccgagtaca
gcccgtggcagagctcttcagaaggctatgcgagctatgagtttaaggcatgaggagtct
catgaaattgaggaacagttcatattgcgtctgccaccggtaactgatggacatcatgca
gttgttcaagtagaaaatgtttcactgcctgctaagctggttaatttgccttgtgttatt
ggaagcctgaaaactgttgatagaaaaacattttatcagacagcggatatttctcagatg
cttgtatgcagtcctgaaggtgagcctcattcttctcctgaagaaccagttatctctact
ggtcctactgttactggacatattgaagggaaggcagagaaaaaaaagtataactggaag
cacggcattactccaccacttaagaatgtcagaaagaaaaggttccggaaaacaacaaaa
aagctcccagatgtcaaacaaatggatgaaatcaacttcagtgagtacactcagtctcca
agtgtggaaaaggaagtgaagagactgctatgctcagatgctgaagctgtcagtgtccgc
tgggaagttgttgctgatgatgatactaaggaaatagaaagtcaagggtgcatctcaact
acttcaggaaccccacagatgggtggtgctggttcatcagaatatgatgtgcttcgggag
atgatgggcgagactggcagcaatagtaatgatgtggaagataagaatagcaaaattgag
gatgaggatgaggatgatcaagaggatgaagatgaagatgatggaaatgaagaaaaagag
gaggagacagacaattctgaagaagagttagaaaaggagctgcaagccaaatttattcaa
tctagcctccatgaaaaagaacaagattacacttcaataatcatggaaattcagaaactg
attcatatcaaagaacaaaagctccagcaaatttataaaaaagcccagcgacagaaggat
ctccttcggaatgtggaaaacttgaccctcaagagacatttccagaatgttttggagaag
cttaacatactggaaaaagagaagtgtgagcagatttatcacctacaggaacaactgaaa
tgtttcctgaaggagtaa

DBGET integrated database retrieval system