KEGG   Rattus norvegicus (rat): 363494
Entry
363494            CDS       T01003                                 

Gene name
Gla
Definition
(RefSeq) alpha-galactosidase A
  KO
K01189  alpha-galactosidase [EC:3.2.1.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00052  Galactose metabolism
rno00561  Glycerolipid metabolism
rno00600  Sphingolipid metabolism
rno00603  Glycosphingolipid biosynthesis - globo and isoglobo series
rno01100  Metabolic pathways
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    363494 (Gla)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    363494 (Gla)
   00600 Sphingolipid metabolism
    363494 (Gla)
  09107 Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    363494 (Gla)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    363494 (Gla)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     363494 (Gla)
SSDB
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase Melibiase_C
Other DBs
NCBI-GeneID: 363494
NCBI-ProteinID: NP_001102290
RGD: 1589721
Ensembl: ENSRNOG00000011513
Position
X
AA seq 421 aa
MAMKLLSGDTPLVCELALRPLALVFWSILGARALDNGLARTPTMGWLHWERFMCNLDCQE
EPDACISEQLFMQMAELMVSDGWRDAGYEYLCIDDCWMAPERDSKGRLQADPKRFPSGIK
HLANYVHSKGLKLGIYADVGKKTCAGFPGSFGSYDIDAQTFADWGIDLLKFDGCHCDSVV
SLANGYKYMSLALNRTGRSIVYSCEWPLYLRPFHKPNYTDIQYYCNHWRNFDDVYDSWES
IKSILAWTVTHQKDIVEVAGPGGWNDPDMLVIGNFGLSWDQQVTQMALWAIMAAPLLMSN
DLRQISSQAKALLQNEDVIAINQDPLGKQGYCFRKENEIEVWERPLSNLAWAVAVRNLQE
IGGPRFYTIQISSLGRGLACNPGCIITQILPEKVHLGFYEWPLTLKTRINPSGTVLLRLE
R
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggccatgaagcttttgagcggagatacaccgctggtctgtgagcttgcgcttcgcccc
ctggctttagttttctggagcattcttggggccagagcattggacaatggcttggcgcgg
acacctactatgggctggctgcactgggaacgtttcatgtgcaaccttgactgccaagaa
gagcctgatgcctgcataagtgagcaactgttcatgcagatggcagagctcatggtctct
gatggctggagggacgcgggttatgaatacctctgcatagatgactgctggatggctccc
gagagggattcaaagggccggcttcaggcagatcccaagcgctttcctagtgggatcaaa
cacctcgctaattacgtccacagcaaaggcttaaagctagggatttatgcagatgttggc
aagaaaacctgtgcaggtttccctgggagctttggatcctatgacattgatgcccagaca
tttgctgactggggtatagatctgctaaaatttgatggttgtcactgtgacagtgtggta
tccttggcgaatggttacaagtacatgtccttggccttgaacaggactggcagaagtatt
gtgtactcctgtgagtggcctctttatttgagaccctttcataagcctaattatacagat
atccaatattactgcaatcactggagaaattttgatgatgtttatgattcctgggaaagc
ataaagtctatcttggcctggacagtaactcaccagaaggacattgttgaagtcgccgga
ccagggggctggaatgacccagacatgttagtgattggcaactttggcctcagttgggac
cagcaggtaacacagatggccctctgggctatcatggcagctcctctactcatgtccaat
gatctccgacaaatcagctctcaagccaaggctctacttcagaatgaggatgtaattgcc
atcaaccaagaccccttgggcaagcaggggtactgttttagaaaggaaaacgaaattgag
gtttgggaacggccactctcaaacctagcctgggccgtggctgtgagaaacctgcaggag
attggtggacctcgtttttacaccatccagatttcttccctgggtcgaggactagcctgc
aatcctggctgcatcatcactcagattctccctgagaaagtacatctaggcttctatgaa
tggcctttaaccttaaaaactcgaataaatccctcaggtactgttttgcttcggttagaa
agataa

DBGET integrated database retrieval system